Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4P807

Protein Details
Accession F4P807   
Localization Confidence Low
Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
35-61IIWSRRVKVHQIKKCKNENKCSRDIKEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 12, mito 6, cyto 5.5
Family & Domain DBs
Amino Acid Sequences FCGQESPCDWYCFQKIPTPDSIGYTCILLKQKHIIIWSRRVKVHQIKKCKNENKCSRDIKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.33
3 0.34
4 0.38
5 0.37
6 0.33
7 0.32
8 0.31
9 0.26
10 0.23
11 0.2
12 0.15
13 0.14
14 0.18
15 0.15
16 0.15
17 0.17
18 0.18
19 0.19
20 0.21
21 0.25
22 0.25
23 0.35
24 0.42
25 0.42
26 0.43
27 0.44
28 0.51
29 0.54
30 0.6
31 0.59
32 0.63
33 0.68
34 0.75
35 0.84
36 0.84
37 0.83
38 0.84
39 0.86
40 0.83
41 0.84