Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A642UF42

Protein Details
Accession A0A642UF42    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MAKKRKNSGRNKKGRGHVKPVRCLNCBasic
83-114IVRVRSREDRKIRTPPQRKRFNQDRKVSPQDAHydrophilic
NLS Segment(s)
PositionSequence
3-19KKRKNSGRNKKGRGHVK
89-102REDRKIRTPPQRKR
Subcellular Location(s) mito 13, nucl 8.5, cyto_nucl 7.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MAKKRKNSGRNKKGRGHVKPVRCLNCARCVPKDKAIKRVTIRNMVEAAAVRDLSDASVYKEYALPKLYNKLHYCVSCAIHARIVRVRSREDRKIRTPPQRKRFNQDRKVSPQDAAKKATA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.86
3 0.85
4 0.83
5 0.8
6 0.81
7 0.82
8 0.77
9 0.69
10 0.67
11 0.61
12 0.62
13 0.6
14 0.55
15 0.53
16 0.54
17 0.56
18 0.58
19 0.64
20 0.58
21 0.6
22 0.59
23 0.59
24 0.57
25 0.61
26 0.58
27 0.57
28 0.54
29 0.46
30 0.44
31 0.36
32 0.33
33 0.25
34 0.2
35 0.12
36 0.11
37 0.08
38 0.07
39 0.07
40 0.06
41 0.06
42 0.05
43 0.07
44 0.08
45 0.08
46 0.08
47 0.1
48 0.11
49 0.12
50 0.14
51 0.13
52 0.13
53 0.21
54 0.23
55 0.28
56 0.29
57 0.3
58 0.32
59 0.31
60 0.33
61 0.29
62 0.28
63 0.24
64 0.25
65 0.23
66 0.23
67 0.23
68 0.24
69 0.25
70 0.27
71 0.29
72 0.29
73 0.34
74 0.39
75 0.46
76 0.53
77 0.58
78 0.62
79 0.66
80 0.73
81 0.77
82 0.79
83 0.82
84 0.83
85 0.84
86 0.87
87 0.85
88 0.85
89 0.87
90 0.87
91 0.86
92 0.85
93 0.84
94 0.83
95 0.85
96 0.78
97 0.71
98 0.68
99 0.68
100 0.64