Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A642UH34

Protein Details
Accession A0A642UH34    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
28-63GHGAQTRKTKPKPAVPPDKAKGAKPKGNRNRAKSPSHydrophilic
88-111ANGNGNKSKKKQQQQQQQQNTQSTHydrophilic
NLS Segment(s)
PositionSequence
34-61RKTKPKPAVPPDKAKGAKPKGNRNRAKS
Subcellular Location(s) mito 12, nucl 9, cyto_nucl 8.5, cyto 6
Family & Domain DBs
Pfam View protein in Pfam  
PF15365  PNRC  
Amino Acid Sequences MMAHQVPHQVPVHVEDRRLPNGAKVDFGHGAQTRKTKPKPAVPPDKAKGAKPKGNRNRAKSPSLPNGDKPDYSSFNAKPTANGDKPIANGNGNKSKKKQQQQQQQQNTQSTPMALGDSYAGSSFHSSPEAVALPKPTFKTKSPPPSNLSTAYPAGSAPATASPMYPQRTPYMMNQPVPGHPQPQHVLGQPQPMLGQPQHIPQGQLMPHPPHPIPANVHPGFTYQVNPQGFIVYPPQPGAGPVPGYGGPITTHFQQPIPQVQPTQQQGQRITFADLMGSQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.31
3 0.36
4 0.39
5 0.41
6 0.37
7 0.36
8 0.41
9 0.4
10 0.37
11 0.32
12 0.34
13 0.32
14 0.31
15 0.32
16 0.28
17 0.3
18 0.31
19 0.38
20 0.4
21 0.49
22 0.54
23 0.56
24 0.6
25 0.67
26 0.74
27 0.76
28 0.8
29 0.78
30 0.83
31 0.77
32 0.79
33 0.72
34 0.66
35 0.66
36 0.64
37 0.64
38 0.62
39 0.7
40 0.7
41 0.79
42 0.82
43 0.79
44 0.81
45 0.8
46 0.79
47 0.75
48 0.72
49 0.71
50 0.71
51 0.67
52 0.61
53 0.63
54 0.59
55 0.52
56 0.47
57 0.43
58 0.38
59 0.37
60 0.39
61 0.31
62 0.32
63 0.37
64 0.33
65 0.29
66 0.29
67 0.36
68 0.3
69 0.32
70 0.29
71 0.27
72 0.28
73 0.3
74 0.27
75 0.21
76 0.22
77 0.26
78 0.34
79 0.36
80 0.39
81 0.39
82 0.48
83 0.54
84 0.62
85 0.65
86 0.66
87 0.73
88 0.8
89 0.87
90 0.87
91 0.85
92 0.81
93 0.75
94 0.66
95 0.56
96 0.45
97 0.34
98 0.24
99 0.17
100 0.12
101 0.08
102 0.07
103 0.06
104 0.06
105 0.06
106 0.05
107 0.05
108 0.05
109 0.07
110 0.07
111 0.07
112 0.08
113 0.07
114 0.07
115 0.08
116 0.09
117 0.08
118 0.08
119 0.1
120 0.1
121 0.12
122 0.14
123 0.16
124 0.18
125 0.19
126 0.26
127 0.32
128 0.42
129 0.46
130 0.5
131 0.5
132 0.52
133 0.53
134 0.48
135 0.41
136 0.33
137 0.28
138 0.23
139 0.19
140 0.14
141 0.12
142 0.09
143 0.08
144 0.06
145 0.05
146 0.06
147 0.06
148 0.07
149 0.08
150 0.13
151 0.15
152 0.16
153 0.17
154 0.18
155 0.19
156 0.21
157 0.24
158 0.3
159 0.32
160 0.32
161 0.34
162 0.33
163 0.33
164 0.37
165 0.34
166 0.27
167 0.25
168 0.28
169 0.27
170 0.28
171 0.29
172 0.25
173 0.27
174 0.25
175 0.29
176 0.24
177 0.23
178 0.2
179 0.18
180 0.2
181 0.16
182 0.18
183 0.14
184 0.17
185 0.21
186 0.22
187 0.22
188 0.19
189 0.25
190 0.22
191 0.24
192 0.25
193 0.25
194 0.28
195 0.31
196 0.31
197 0.29
198 0.3
199 0.3
200 0.31
201 0.33
202 0.39
203 0.35
204 0.36
205 0.33
206 0.32
207 0.3
208 0.26
209 0.23
210 0.15
211 0.22
212 0.22
213 0.23
214 0.21
215 0.21
216 0.2
217 0.19
218 0.22
219 0.17
220 0.18
221 0.18
222 0.18
223 0.17
224 0.18
225 0.19
226 0.17
227 0.15
228 0.14
229 0.16
230 0.16
231 0.17
232 0.16
233 0.14
234 0.12
235 0.14
236 0.16
237 0.16
238 0.2
239 0.2
240 0.21
241 0.24
242 0.28
243 0.34
244 0.35
245 0.36
246 0.34
247 0.37
248 0.45
249 0.45
250 0.5
251 0.44
252 0.47
253 0.48
254 0.5
255 0.5
256 0.44
257 0.43
258 0.35
259 0.32
260 0.26