Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A642URT5

Protein Details
Accession A0A642URT5    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
301-322HQYLRWTKSRQRRMQILRRAMRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 8cysk 8, cyto 5, mito_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003107  HAT  
IPR011990  TPR-like_helical_dom_sf  
Gene Ontology GO:0032991  C:protein-containing complex  
GO:0006396  P:RNA processing  
Amino Acid Sequences MDPSSTELEWIAASTALLRSPDDLELWKKLTQVSSDKLTKASPAQDVALARQSYDSLLERFPLLYNYWIQYAELELRIGNTKRAESVYRQGLGKLSYCVELWVTFLEFKVSTLTNNLDELFEMFEMARGKIGYHYHAYEFYRLYLDFLQHYGFEKQYYVLLRIVLEVPLYHYSYFFKKWFDTIARFNQLEGTDREHLLNLVVPASEMEKAKRFDNKQLVMYLKKYFVDMYIATQFRVFEVYPLEKELDRPYFDVAPLSKQQLDAWEAYTTFVELRSTSEAAITLAYERAVVATASYPQLWHQYLRWTKSRQRRMQILRRAMRYCRDPVFVVKLADEYAQRQQFLAARDVVVEAIAHSSDVPFMWYESLLSLEWSMSAKDKDAESYWRGIFEEIIATTNSDYWFIHMLNYSVSKETKFAILEHYAADFGSRPLYQRARSTLDGPPAPPTYDEMIAKYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.1
4 0.11
5 0.11
6 0.12
7 0.14
8 0.16
9 0.16
10 0.2
11 0.22
12 0.26
13 0.29
14 0.28
15 0.28
16 0.3
17 0.31
18 0.33
19 0.36
20 0.36
21 0.41
22 0.44
23 0.44
24 0.43
25 0.41
26 0.38
27 0.36
28 0.36
29 0.31
30 0.28
31 0.28
32 0.3
33 0.3
34 0.29
35 0.32
36 0.27
37 0.24
38 0.22
39 0.21
40 0.18
41 0.21
42 0.2
43 0.15
44 0.16
45 0.17
46 0.17
47 0.17
48 0.18
49 0.16
50 0.15
51 0.16
52 0.18
53 0.19
54 0.2
55 0.19
56 0.18
57 0.16
58 0.17
59 0.17
60 0.15
61 0.14
62 0.12
63 0.13
64 0.2
65 0.2
66 0.22
67 0.21
68 0.22
69 0.24
70 0.27
71 0.29
72 0.27
73 0.35
74 0.37
75 0.38
76 0.37
77 0.36
78 0.36
79 0.34
80 0.3
81 0.24
82 0.19
83 0.17
84 0.16
85 0.16
86 0.15
87 0.13
88 0.12
89 0.11
90 0.11
91 0.1
92 0.1
93 0.11
94 0.1
95 0.11
96 0.13
97 0.12
98 0.11
99 0.14
100 0.16
101 0.15
102 0.16
103 0.16
104 0.13
105 0.13
106 0.13
107 0.11
108 0.09
109 0.08
110 0.07
111 0.09
112 0.1
113 0.1
114 0.11
115 0.1
116 0.1
117 0.13
118 0.15
119 0.16
120 0.18
121 0.19
122 0.19
123 0.24
124 0.25
125 0.24
126 0.23
127 0.2
128 0.2
129 0.18
130 0.19
131 0.16
132 0.16
133 0.13
134 0.14
135 0.13
136 0.12
137 0.15
138 0.14
139 0.14
140 0.13
141 0.13
142 0.12
143 0.15
144 0.15
145 0.15
146 0.14
147 0.14
148 0.13
149 0.14
150 0.14
151 0.11
152 0.1
153 0.07
154 0.09
155 0.11
156 0.12
157 0.11
158 0.11
159 0.12
160 0.15
161 0.19
162 0.18
163 0.18
164 0.18
165 0.19
166 0.23
167 0.25
168 0.27
169 0.29
170 0.34
171 0.37
172 0.37
173 0.36
174 0.34
175 0.3
176 0.29
177 0.24
178 0.23
179 0.19
180 0.2
181 0.2
182 0.17
183 0.16
184 0.13
185 0.13
186 0.08
187 0.07
188 0.06
189 0.06
190 0.06
191 0.07
192 0.08
193 0.08
194 0.09
195 0.13
196 0.15
197 0.18
198 0.24
199 0.26
200 0.32
201 0.4
202 0.41
203 0.38
204 0.4
205 0.41
206 0.36
207 0.36
208 0.3
209 0.23
210 0.21
211 0.19
212 0.16
213 0.13
214 0.13
215 0.11
216 0.12
217 0.16
218 0.16
219 0.15
220 0.16
221 0.15
222 0.13
223 0.14
224 0.12
225 0.07
226 0.1
227 0.11
228 0.11
229 0.12
230 0.14
231 0.12
232 0.13
233 0.17
234 0.16
235 0.16
236 0.16
237 0.17
238 0.17
239 0.17
240 0.18
241 0.14
242 0.15
243 0.16
244 0.17
245 0.16
246 0.15
247 0.16
248 0.16
249 0.17
250 0.14
251 0.14
252 0.13
253 0.12
254 0.12
255 0.12
256 0.1
257 0.08
258 0.07
259 0.06
260 0.06
261 0.08
262 0.1
263 0.1
264 0.1
265 0.1
266 0.1
267 0.09
268 0.09
269 0.08
270 0.05
271 0.05
272 0.05
273 0.05
274 0.05
275 0.05
276 0.05
277 0.05
278 0.04
279 0.05
280 0.06
281 0.07
282 0.07
283 0.07
284 0.08
285 0.13
286 0.14
287 0.14
288 0.14
289 0.23
290 0.29
291 0.33
292 0.39
293 0.41
294 0.49
295 0.58
296 0.68
297 0.67
298 0.69
299 0.75
300 0.78
301 0.82
302 0.83
303 0.83
304 0.79
305 0.77
306 0.73
307 0.67
308 0.62
309 0.57
310 0.53
311 0.46
312 0.42
313 0.37
314 0.37
315 0.4
316 0.37
317 0.33
318 0.27
319 0.24
320 0.22
321 0.22
322 0.19
323 0.16
324 0.2
325 0.22
326 0.21
327 0.21
328 0.22
329 0.24
330 0.26
331 0.27
332 0.2
333 0.18
334 0.18
335 0.18
336 0.15
337 0.12
338 0.09
339 0.06
340 0.06
341 0.06
342 0.05
343 0.05
344 0.05
345 0.06
346 0.06
347 0.07
348 0.06
349 0.07
350 0.07
351 0.07
352 0.08
353 0.08
354 0.09
355 0.08
356 0.09
357 0.09
358 0.08
359 0.08
360 0.09
361 0.09
362 0.11
363 0.12
364 0.13
365 0.15
366 0.16
367 0.18
368 0.2
369 0.25
370 0.24
371 0.29
372 0.28
373 0.27
374 0.27
375 0.24
376 0.22
377 0.17
378 0.17
379 0.12
380 0.13
381 0.12
382 0.12
383 0.11
384 0.13
385 0.13
386 0.12
387 0.11
388 0.12
389 0.15
390 0.14
391 0.16
392 0.15
393 0.15
394 0.17
395 0.2
396 0.19
397 0.2
398 0.21
399 0.2
400 0.2
401 0.21
402 0.22
403 0.2
404 0.19
405 0.22
406 0.23
407 0.23
408 0.23
409 0.23
410 0.18
411 0.17
412 0.17
413 0.12
414 0.1
415 0.13
416 0.13
417 0.14
418 0.23
419 0.3
420 0.33
421 0.39
422 0.44
423 0.47
424 0.49
425 0.51
426 0.49
427 0.51
428 0.5
429 0.45
430 0.44
431 0.4
432 0.39
433 0.35
434 0.33
435 0.29
436 0.3
437 0.31