Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4NRH8

Protein Details
Accession F4NRH8   
Localization Confidence Medium
Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
21-47VKTAEKKTKDATKSKKKTRKETYSTYIHydrophilic
NLS Segment(s)
PositionSequence
17-40GKAPVKTAEKKTKDATKSKKKTRK
Subcellular Location(s) nucl 23, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR007125  Histone_H2A/H2B/H3  
IPR000558  Histone_H2B  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Pfam View protein in Pfam  
PF00125  Histone  
PROSITE View protein in PROSITE  
PS00357  HISTONE_H2B  
Amino Acid Sequences MQIADEELQSFITKPAGKAPVKTAEKKTKDATKSKKKTRKETYSTYIYKVLKQVHPDTGISNKAMSIMNSFVNDIFERIAGEASKLASYNKRSTISSREVQTSVRLILPGELAKHAVSEGTKAVTKYQSSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.22
3 0.3
4 0.31
5 0.33
6 0.37
7 0.43
8 0.47
9 0.53
10 0.56
11 0.58
12 0.61
13 0.63
14 0.65
15 0.63
16 0.65
17 0.68
18 0.7
19 0.7
20 0.76
21 0.82
22 0.84
23 0.85
24 0.88
25 0.89
26 0.89
27 0.84
28 0.82
29 0.78
30 0.78
31 0.71
32 0.63
33 0.59
34 0.49
35 0.43
36 0.4
37 0.38
38 0.32
39 0.34
40 0.34
41 0.31
42 0.32
43 0.3
44 0.27
45 0.25
46 0.23
47 0.19
48 0.16
49 0.12
50 0.12
51 0.12
52 0.1
53 0.09
54 0.09
55 0.09
56 0.09
57 0.1
58 0.08
59 0.09
60 0.09
61 0.08
62 0.07
63 0.06
64 0.06
65 0.06
66 0.07
67 0.05
68 0.06
69 0.06
70 0.06
71 0.07
72 0.07
73 0.09
74 0.13
75 0.18
76 0.22
77 0.26
78 0.28
79 0.29
80 0.32
81 0.37
82 0.39
83 0.39
84 0.38
85 0.37
86 0.36
87 0.35
88 0.34
89 0.3
90 0.25
91 0.2
92 0.18
93 0.14
94 0.14
95 0.16
96 0.14
97 0.13
98 0.13
99 0.13
100 0.13
101 0.12
102 0.12
103 0.11
104 0.1
105 0.11
106 0.12
107 0.14
108 0.16
109 0.17
110 0.21
111 0.24