Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F4P6B8

Protein Details
Accession F4P6B8    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
12-38KGTTSGSKISKKNKKSKKTSHTTPGSNHydrophilic
NLS Segment(s)
PositionSequence
19-29KISKKNKKSKK
Subcellular Location(s) nucl 17.5, mito_nucl 12.666, cyto_nucl 11.333, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MDGFVGGALKLKGTTSGSKISKKNKKSKKTSHTTPGSNDTSTTHTTTESKEKSVDSGMTEAERKFREVQRKRLDAKAEKIASKSHKERVADLNAYLESLSEHHDIPRVGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.28
4 0.33
5 0.4
6 0.46
7 0.54
8 0.61
9 0.67
10 0.74
11 0.76
12 0.81
13 0.85
14 0.89
15 0.89
16 0.89
17 0.88
18 0.87
19 0.85
20 0.78
21 0.72
22 0.68
23 0.6
24 0.5
25 0.42
26 0.33
27 0.29
28 0.27
29 0.24
30 0.18
31 0.16
32 0.17
33 0.19
34 0.25
35 0.22
36 0.21
37 0.21
38 0.21
39 0.2
40 0.21
41 0.19
42 0.11
43 0.11
44 0.1
45 0.1
46 0.12
47 0.11
48 0.14
49 0.13
50 0.15
51 0.18
52 0.23
53 0.33
54 0.39
55 0.49
56 0.55
57 0.62
58 0.63
59 0.64
60 0.67
61 0.63
62 0.61
63 0.6
64 0.54
65 0.48
66 0.46
67 0.47
68 0.44
69 0.46
70 0.46
71 0.44
72 0.46
73 0.45
74 0.48
75 0.5
76 0.52
77 0.45
78 0.4
79 0.36
80 0.31
81 0.29
82 0.25
83 0.17
84 0.11
85 0.09
86 0.13
87 0.12
88 0.12
89 0.13
90 0.18
91 0.18