Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I7JU03

Protein Details
Accession I7JU03    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
41-60CEEFRKAKRSRESRRRVLGLBasic
NLS Segment(s)
PositionSequence
46-55KAKRSRESRR
Subcellular Location(s) nucl 16.5, cyto_nucl 10.5, mito 6, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010920  LSM_dom_sf  
IPR047575  Sm  
IPR001163  Sm_dom_euk/arc  
Pfam View protein in Pfam  
PF01423  LSM  
PROSITE View protein in PROSITE  
PS52002  SM  
CDD cd01717  Sm_B  
Amino Acid Sequences MGSNLTKYIDYRVKVRMRDGRWMEGTMLAVDEDVNVVLDDCEEFRKAKRSRESRRRVLGLVVVRGDFVVDVEIVSKPDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.51
3 0.52
4 0.48
5 0.57
6 0.57
7 0.55
8 0.5
9 0.49
10 0.41
11 0.34
12 0.31
13 0.21
14 0.17
15 0.1
16 0.08
17 0.06
18 0.05
19 0.04
20 0.03
21 0.03
22 0.03
23 0.03
24 0.03
25 0.03
26 0.03
27 0.04
28 0.05
29 0.06
30 0.06
31 0.08
32 0.18
33 0.21
34 0.29
35 0.39
36 0.49
37 0.59
38 0.69
39 0.78
40 0.78
41 0.83
42 0.78
43 0.69
44 0.61
45 0.56
46 0.49
47 0.43
48 0.35
49 0.27
50 0.23
51 0.22
52 0.19
53 0.13
54 0.09
55 0.06
56 0.05
57 0.05
58 0.06
59 0.07