Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A642UUR5

Protein Details
Accession A0A642UUR5    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
79-112LDSVLRKRRLKMKKHKLRKRRREQRALKKRLGKLBasic
NLS Segment(s)
PositionSequence
84-112RKRRLKMKKHKLRKRRREQRALKKRLGKL
Subcellular Location(s) mito 22, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013177  COX24_C  
Pfam View protein in Pfam  
PF08213  COX24_C  
Amino Acid Sequences MLRGVFRALPTIPMRFMSAGSLVRRTFVMPQFVKPQEFAIIHEKLPVTIGTITREIQENQKVLDAFGDSTEEVDRTMYLDSVLRKRRLKMKKHKLRKRRREQRALKKRLGKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.22
3 0.22
4 0.18
5 0.18
6 0.2
7 0.2
8 0.24
9 0.22
10 0.22
11 0.22
12 0.22
13 0.24
14 0.23
15 0.3
16 0.26
17 0.3
18 0.37
19 0.39
20 0.39
21 0.33
22 0.31
23 0.27
24 0.26
25 0.25
26 0.23
27 0.22
28 0.21
29 0.23
30 0.22
31 0.17
32 0.17
33 0.14
34 0.1
35 0.1
36 0.11
37 0.11
38 0.12
39 0.13
40 0.12
41 0.14
42 0.13
43 0.15
44 0.18
45 0.16
46 0.15
47 0.17
48 0.17
49 0.15
50 0.15
51 0.11
52 0.08
53 0.08
54 0.08
55 0.06
56 0.07
57 0.07
58 0.07
59 0.06
60 0.06
61 0.06
62 0.06
63 0.06
64 0.06
65 0.06
66 0.09
67 0.13
68 0.21
69 0.28
70 0.34
71 0.38
72 0.43
73 0.52
74 0.59
75 0.66
76 0.7
77 0.74
78 0.78
79 0.86
80 0.92
81 0.93
82 0.95
83 0.95
84 0.96
85 0.95
86 0.95
87 0.95
88 0.96
89 0.96
90 0.96
91 0.94
92 0.92