Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A642UVV0

Protein Details
Accession A0A642UVV0    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
71-98KEADIMKWRKRQLRKANIKRINNNNFLSHydrophilic
NLS Segment(s)
PositionSequence
79-85RKRQLRK
Subcellular Location(s) mito 21, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MRSWVRALHVSRTVLAAPKPAASVVSSCPAGTVLNLKIKKSGDEPVALEDAEYPEWLWTLLDKQKKDADLKEADIMKWRKRQLRKANIKRINNNNFLSKM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.27
3 0.25
4 0.2
5 0.19
6 0.19
7 0.17
8 0.16
9 0.13
10 0.14
11 0.12
12 0.15
13 0.14
14 0.13
15 0.13
16 0.13
17 0.12
18 0.11
19 0.12
20 0.12
21 0.19
22 0.21
23 0.21
24 0.24
25 0.24
26 0.26
27 0.24
28 0.26
29 0.2
30 0.21
31 0.21
32 0.19
33 0.19
34 0.17
35 0.15
36 0.11
37 0.1
38 0.08
39 0.07
40 0.05
41 0.05
42 0.05
43 0.05
44 0.05
45 0.04
46 0.08
47 0.14
48 0.19
49 0.2
50 0.23
51 0.27
52 0.3
53 0.34
54 0.32
55 0.33
56 0.31
57 0.33
58 0.35
59 0.33
60 0.3
61 0.35
62 0.37
63 0.38
64 0.42
65 0.47
66 0.5
67 0.58
68 0.68
69 0.71
70 0.77
71 0.82
72 0.86
73 0.9
74 0.91
75 0.92
76 0.91
77 0.9
78 0.88
79 0.85
80 0.78