Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A642UDW8

Protein Details
Accession A0A642UDW8    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
54-79DSKERIRESRKKQKEIEKKRKQAEEEBasic
NLS Segment(s)
PositionSequence
57-74ERIRESRKKQKEIEKKRK
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013892  Cyt_c_biogenesis_Cmc1-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Pfam View protein in Pfam  
PF08583  Cmc1  
Amino Acid Sequences MHPQLDKRRFDTCEALMDALEECHRTEFLKQALGKCNYEKDQLARCLHYTRVEDSKERIRESRKKQKEIEKKRKQAEEELYGKNGYLKKVVELEMQKQQASK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.37
3 0.29
4 0.27
5 0.22
6 0.17
7 0.15
8 0.1
9 0.09
10 0.09
11 0.1
12 0.1
13 0.11
14 0.16
15 0.17
16 0.22
17 0.24
18 0.28
19 0.36
20 0.38
21 0.39
22 0.35
23 0.38
24 0.34
25 0.35
26 0.32
27 0.28
28 0.3
29 0.35
30 0.35
31 0.32
32 0.31
33 0.3
34 0.3
35 0.29
36 0.25
37 0.21
38 0.24
39 0.25
40 0.24
41 0.26
42 0.33
43 0.32
44 0.32
45 0.34
46 0.37
47 0.45
48 0.54
49 0.61
50 0.63
51 0.67
52 0.72
53 0.78
54 0.81
55 0.83
56 0.85
57 0.84
58 0.84
59 0.85
60 0.85
61 0.78
62 0.75
63 0.71
64 0.69
65 0.64
66 0.58
67 0.51
68 0.45
69 0.41
70 0.37
71 0.32
72 0.25
73 0.23
74 0.21
75 0.22
76 0.25
77 0.28
78 0.3
79 0.32
80 0.36
81 0.4
82 0.42