Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F4P3V8

Protein Details
Accession F4P3V8    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MGKRKSSKKPQAKIKMVLDKEHydrophilic
NLS Segment(s)
PositionSequence
4-9RKSSKK
Subcellular Location(s) mito 21, cyto_nucl 4, nucl 3, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0008023  C:transcription elongation factor complex  
GO:0046872  F:metal ion binding  
GO:0000993  F:RNA polymerase II complex binding  
GO:0006368  P:transcription elongation by RNA polymerase II  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKSSKKPQAKIKMVLDKEFSCLFCNHEKTVTCKMDMENKIGQLTCSACGVSFQSMVTKLSEPVDVFSDWIDACE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.83
3 0.76
4 0.69
5 0.63
6 0.52
7 0.48
8 0.41
9 0.33
10 0.25
11 0.23
12 0.23
13 0.24
14 0.27
15 0.24
16 0.26
17 0.27
18 0.29
19 0.38
20 0.36
21 0.3
22 0.28
23 0.28
24 0.33
25 0.33
26 0.32
27 0.25
28 0.24
29 0.24
30 0.23
31 0.22
32 0.14
33 0.14
34 0.11
35 0.1
36 0.09
37 0.08
38 0.08
39 0.1
40 0.1
41 0.09
42 0.09
43 0.1
44 0.12
45 0.13
46 0.14
47 0.14
48 0.13
49 0.14
50 0.17
51 0.15
52 0.16
53 0.18
54 0.16
55 0.15
56 0.14
57 0.15