Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A642UIQ1

Protein Details
Accession A0A642UIQ1    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
105-134FDAYRECRKDFSKKKRQDRRDGVRGWNPWRBasic
NLS Segment(s)
PositionSequence
117-123KKKRQDR
Subcellular Location(s) nucl 12, cyto 8, pero 3, mito 1, golg 1, cysk 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
Gene Ontology GO:0005758  C:mitochondrial intermembrane space  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MAAAESTPPLGDPQSPPPAAGDGAARDGSPHLKSDAVEMDKSKVDFTKDGAYKFYPDNPENHRHKYRWSTKEPSKFYDPCEQSRQASLDCILRNQDDRLVCQDFFDAYRECRKDFSKKKRQDRRDGVRGWNPWR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.29
4 0.29
5 0.3
6 0.27
7 0.24
8 0.18
9 0.12
10 0.14
11 0.14
12 0.13
13 0.11
14 0.13
15 0.15
16 0.14
17 0.15
18 0.13
19 0.14
20 0.14
21 0.17
22 0.22
23 0.21
24 0.21
25 0.21
26 0.22
27 0.23
28 0.23
29 0.21
30 0.16
31 0.16
32 0.15
33 0.17
34 0.23
35 0.24
36 0.24
37 0.26
38 0.25
39 0.25
40 0.25
41 0.27
42 0.24
43 0.23
44 0.27
45 0.3
46 0.38
47 0.41
48 0.47
49 0.48
50 0.43
51 0.48
52 0.53
53 0.57
54 0.56
55 0.58
56 0.59
57 0.62
58 0.71
59 0.68
60 0.63
61 0.61
62 0.54
63 0.51
64 0.52
65 0.48
66 0.43
67 0.46
68 0.43
69 0.37
70 0.38
71 0.36
72 0.27
73 0.25
74 0.22
75 0.2
76 0.19
77 0.19
78 0.18
79 0.18
80 0.19
81 0.19
82 0.22
83 0.18
84 0.2
85 0.24
86 0.25
87 0.24
88 0.22
89 0.22
90 0.19
91 0.19
92 0.2
93 0.17
94 0.16
95 0.25
96 0.27
97 0.27
98 0.31
99 0.36
100 0.43
101 0.52
102 0.61
103 0.63
104 0.71
105 0.81
106 0.88
107 0.92
108 0.93
109 0.93
110 0.92
111 0.92
112 0.87
113 0.86
114 0.83