Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A642UMP5

Protein Details
Accession A0A642UMP5    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MSTAEKKKVTRKKRDPDAPKRSLSAHydrophilic
NLS Segment(s)
PositionSequence
6-17KKKVTRKKRDPD
Subcellular Location(s) nucl 15.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MSTAEKKKVTRKKRDPDAPKRSLSAYMFFANENRDVVRSENPGVSFGQVGKLLGEKWKALTSEEKTPYEAKAEADKKRYEKEKAEYAKKQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.92
3 0.93
4 0.93
5 0.88
6 0.8
7 0.72
8 0.63
9 0.58
10 0.48
11 0.4
12 0.33
13 0.28
14 0.25
15 0.23
16 0.23
17 0.19
18 0.18
19 0.15
20 0.12
21 0.11
22 0.12
23 0.13
24 0.15
25 0.16
26 0.16
27 0.17
28 0.17
29 0.17
30 0.16
31 0.15
32 0.12
33 0.09
34 0.1
35 0.08
36 0.08
37 0.07
38 0.07
39 0.07
40 0.09
41 0.11
42 0.09
43 0.11
44 0.13
45 0.14
46 0.15
47 0.21
48 0.22
49 0.3
50 0.35
51 0.34
52 0.34
53 0.35
54 0.34
55 0.3
56 0.28
57 0.21
58 0.26
59 0.32
60 0.36
61 0.4
62 0.46
63 0.47
64 0.55
65 0.6
66 0.58
67 0.59
68 0.6
69 0.64
70 0.68
71 0.73