Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4P199

Protein Details
Accession F4P199    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
197-218MYSHMIKQRRKYLGPKRSKKHABasic
NLS Segment(s)
PositionSequence
204-218QRRKYLGPKRSKKHA
Subcellular Location(s) plas 11, mito 6, extr 6, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007482  Tyr_Pase-like_PTPLA  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0018812  F:3-hydroxyacyl-CoA dehydratase activity  
GO:0030497  P:fatty acid elongation  
GO:0030148  P:sphingolipid biosynthetic process  
GO:0042761  P:very long-chain fatty acid biosynthetic process  
Pfam View protein in Pfam  
PF04387  PTPLA  
Amino Acid Sequences MKTSTKQRSEHPLVLLWLIVYNVASFVGWAYILTLVLHCLITSNGDYSLSYSVVSYTLELVQLCALLEVLHALVGAVKSPVITTALQISSRLFLVGLCYFFNDSRVRQHIAFTTMVLAWSITEVVRYSYYALSLLAINPSALVWARYTFFYVLYPIGAGSELWLLMRSWDSARQYSTLLYYTLVGMAALYPPGFYVMYSHMIKQRRKYLGPKRSKKHA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.38
3 0.28
4 0.2
5 0.14
6 0.11
7 0.08
8 0.06
9 0.06
10 0.06
11 0.05
12 0.05
13 0.05
14 0.05
15 0.05
16 0.05
17 0.05
18 0.05
19 0.06
20 0.06
21 0.06
22 0.06
23 0.07
24 0.07
25 0.06
26 0.06
27 0.06
28 0.08
29 0.09
30 0.09
31 0.09
32 0.1
33 0.1
34 0.11
35 0.12
36 0.1
37 0.1
38 0.08
39 0.08
40 0.08
41 0.09
42 0.07
43 0.07
44 0.07
45 0.08
46 0.08
47 0.08
48 0.07
49 0.07
50 0.07
51 0.06
52 0.05
53 0.04
54 0.04
55 0.04
56 0.04
57 0.03
58 0.03
59 0.03
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.05
68 0.06
69 0.06
70 0.06
71 0.09
72 0.11
73 0.11
74 0.12
75 0.11
76 0.1
77 0.1
78 0.1
79 0.06
80 0.05
81 0.08
82 0.08
83 0.09
84 0.08
85 0.08
86 0.1
87 0.1
88 0.13
89 0.12
90 0.12
91 0.16
92 0.19
93 0.21
94 0.2
95 0.21
96 0.2
97 0.21
98 0.2
99 0.15
100 0.13
101 0.11
102 0.11
103 0.09
104 0.07
105 0.04
106 0.04
107 0.05
108 0.03
109 0.04
110 0.04
111 0.05
112 0.06
113 0.06
114 0.08
115 0.07
116 0.08
117 0.08
118 0.07
119 0.07
120 0.07
121 0.07
122 0.06
123 0.06
124 0.05
125 0.05
126 0.05
127 0.05
128 0.05
129 0.05
130 0.05
131 0.06
132 0.08
133 0.08
134 0.1
135 0.1
136 0.1
137 0.1
138 0.11
139 0.1
140 0.09
141 0.09
142 0.07
143 0.07
144 0.06
145 0.06
146 0.05
147 0.05
148 0.05
149 0.05
150 0.06
151 0.06
152 0.06
153 0.07
154 0.08
155 0.09
156 0.15
157 0.18
158 0.2
159 0.21
160 0.22
161 0.22
162 0.22
163 0.22
164 0.18
165 0.15
166 0.13
167 0.12
168 0.11
169 0.11
170 0.1
171 0.07
172 0.06
173 0.06
174 0.06
175 0.06
176 0.05
177 0.05
178 0.05
179 0.07
180 0.07
181 0.07
182 0.09
183 0.11
184 0.18
185 0.19
186 0.22
187 0.27
188 0.35
189 0.41
190 0.47
191 0.54
192 0.56
193 0.62
194 0.69
195 0.74
196 0.77
197 0.82
198 0.85