Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5E8BZD7

Protein Details
Accession A0A5E8BZD7    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
88-117EQDPIKAARKLRRQENRKKIKDNNFLAKMSHydrophilic
NLS Segment(s)
PositionSequence
92-108IKAARKLRRQENRKKIK
Subcellular Location(s) mito 23, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MLSILRRSNITAARSLLLTTRFYSAQAAPAAAPAAKPKGPISSCPAGTVIKGLNIRKGQDPIVARPDEEYPEWLWTVLDKKAQDKRLEQDPIKAARKLRRQENRKKIKDNNFLAKMSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.26
3 0.23
4 0.2
5 0.2
6 0.18
7 0.18
8 0.18
9 0.18
10 0.2
11 0.18
12 0.19
13 0.18
14 0.17
15 0.14
16 0.15
17 0.15
18 0.12
19 0.11
20 0.09
21 0.12
22 0.12
23 0.14
24 0.14
25 0.21
26 0.22
27 0.25
28 0.29
29 0.31
30 0.3
31 0.3
32 0.3
33 0.23
34 0.22
35 0.2
36 0.14
37 0.12
38 0.16
39 0.15
40 0.19
41 0.2
42 0.22
43 0.22
44 0.24
45 0.21
46 0.22
47 0.23
48 0.2
49 0.24
50 0.23
51 0.21
52 0.2
53 0.21
54 0.18
55 0.17
56 0.17
57 0.12
58 0.13
59 0.13
60 0.12
61 0.11
62 0.1
63 0.12
64 0.12
65 0.15
66 0.15
67 0.22
68 0.29
69 0.35
70 0.38
71 0.4
72 0.43
73 0.48
74 0.55
75 0.49
76 0.49
77 0.49
78 0.53
79 0.53
80 0.52
81 0.49
82 0.5
83 0.59
84 0.6
85 0.64
86 0.67
87 0.73
88 0.81
89 0.86
90 0.88
91 0.88
92 0.9
93 0.9
94 0.9
95 0.9
96 0.88
97 0.87
98 0.82