Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4NTU7

Protein Details
Accession F4NTU7   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
30-57FLLDIKKKIKRWYRRLHQRRKSINTMCSHydrophilic
NLS Segment(s)
PositionSequence
35-50KKKIKRWYRRLHQRRK
Subcellular Location(s) nucl 17, mito_nucl 12.999, cyto_nucl 11.333, mito 7.5
Family & Domain DBs
Amino Acid Sequences MPTAEISRGMCKESLKSTKGKQNNRSDPIFLLDIKKKIKRWYRRLHQRRKSINTMCSETLVCLNVKVINSNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.34
3 0.39
4 0.44
5 0.51
6 0.59
7 0.65
8 0.66
9 0.7
10 0.76
11 0.75
12 0.71
13 0.63
14 0.55
15 0.48
16 0.4
17 0.29
18 0.24
19 0.23
20 0.25
21 0.28
22 0.31
23 0.31
24 0.38
25 0.47
26 0.52
27 0.59
28 0.66
29 0.72
30 0.8
31 0.88
32 0.91
33 0.91
34 0.91
35 0.91
36 0.88
37 0.86
38 0.82
39 0.78
40 0.72
41 0.68
42 0.59
43 0.51
44 0.43
45 0.34
46 0.29
47 0.24
48 0.18
49 0.13
50 0.14
51 0.15
52 0.15