Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5E8BV09

Protein Details
Accession A0A5E8BV09    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
98-119LKTRGGRKVLARRKTKGRWFLSHydrophilic
NLS Segment(s)
PositionSequence
87-115KRKRINGFLARLKTRGGRKVLARRKTKGR
Subcellular Location(s) mito 23.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MLSRFAAIRPAMRVVASGVASRPLTLLAAQSNPLTALRARMTPGSPTAALVSPLAQPNPLLLPALPDLLDQRRWKARGNTYQPSTLKRKRINGFLARLKTRGGRKVLARRKTKGRWFLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.19
3 0.17
4 0.15
5 0.13
6 0.16
7 0.16
8 0.15
9 0.14
10 0.11
11 0.11
12 0.1
13 0.11
14 0.09
15 0.1
16 0.11
17 0.11
18 0.11
19 0.11
20 0.11
21 0.11
22 0.09
23 0.12
24 0.12
25 0.13
26 0.14
27 0.15
28 0.16
29 0.16
30 0.17
31 0.16
32 0.15
33 0.14
34 0.15
35 0.13
36 0.13
37 0.11
38 0.11
39 0.1
40 0.11
41 0.1
42 0.09
43 0.08
44 0.08
45 0.08
46 0.08
47 0.06
48 0.05
49 0.07
50 0.07
51 0.07
52 0.07
53 0.07
54 0.08
55 0.1
56 0.16
57 0.15
58 0.19
59 0.24
60 0.26
61 0.31
62 0.37
63 0.44
64 0.49
65 0.57
66 0.61
67 0.58
68 0.64
69 0.6
70 0.59
71 0.59
72 0.56
73 0.57
74 0.56
75 0.62
76 0.6
77 0.66
78 0.69
79 0.67
80 0.69
81 0.68
82 0.68
83 0.62
84 0.58
85 0.52
86 0.5
87 0.49
88 0.48
89 0.44
90 0.43
91 0.5
92 0.6
93 0.67
94 0.7
95 0.72
96 0.72
97 0.78
98 0.81
99 0.82
100 0.81