Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5E8B776

Protein Details
Accession A0A5E8B776    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
4-32IPKTRRTFCASKQCRKHTQHKVTQYKAGKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, mito 8, cyto 8, cyto_mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNIPKTRRTFCASKQCRKHTQHKVTQYKAGKASLYAQGKRRYDRKQRGYGGQTKQVFHKKAKTTKKVVLRLECVACKAKAQLPLKRCKHFELGGDKKQKGQALQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.76
3 0.8
4 0.83
5 0.84
6 0.85
7 0.85
8 0.86
9 0.85
10 0.85
11 0.86
12 0.8
13 0.81
14 0.76
15 0.7
16 0.62
17 0.55
18 0.44
19 0.35
20 0.34
21 0.33
22 0.34
23 0.32
24 0.35
25 0.41
26 0.44
27 0.48
28 0.53
29 0.54
30 0.59
31 0.66
32 0.69
33 0.7
34 0.71
35 0.73
36 0.72
37 0.71
38 0.64
39 0.61
40 0.54
41 0.45
42 0.47
43 0.47
44 0.44
45 0.39
46 0.43
47 0.43
48 0.5
49 0.6
50 0.62
51 0.61
52 0.65
53 0.71
54 0.71
55 0.7
56 0.66
57 0.6
58 0.57
59 0.54
60 0.47
61 0.41
62 0.37
63 0.3
64 0.25
65 0.24
66 0.24
67 0.29
68 0.35
69 0.38
70 0.43
71 0.53
72 0.6
73 0.65
74 0.64
75 0.6
76 0.61
77 0.57
78 0.57
79 0.58
80 0.59
81 0.61
82 0.66
83 0.62
84 0.6
85 0.61
86 0.57