Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5E8BQQ0

Protein Details
Accession A0A5E8BQQ0    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-31ALAPHPKIVKKHGNKKFKRHHSDRYARVGEBasic
NLS Segment(s)
PositionSequence
7-50PKIVKKHGNKKFKRHHSDRYARVGESWRKPKGIDSAVRRRFRGT
Subcellular Location(s) nucl 13, mito 7, cyto 7, cyto_mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MALAPHPKIVKKHGNKKFKRHHSDRYARVGESWRKPKGIDSAVRRRFRGTVRMPKIGYGSDKRTKYLAPSGLKSVVVSNAAELDTLILSNKYFAAEIAHSVSSRKRAEIVEKAKTLSIHVTNASARLSSQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.8
3 0.87
4 0.9
5 0.9
6 0.9
7 0.88
8 0.89
9 0.89
10 0.9
11 0.87
12 0.85
13 0.78
14 0.67
15 0.61
16 0.59
17 0.56
18 0.56
19 0.56
20 0.49
21 0.47
22 0.47
23 0.48
24 0.48
25 0.46
26 0.44
27 0.45
28 0.53
29 0.61
30 0.64
31 0.61
32 0.55
33 0.52
34 0.48
35 0.48
36 0.47
37 0.48
38 0.5
39 0.55
40 0.53
41 0.5
42 0.48
43 0.4
44 0.36
45 0.29
46 0.3
47 0.32
48 0.32
49 0.32
50 0.32
51 0.3
52 0.29
53 0.3
54 0.3
55 0.25
56 0.26
57 0.28
58 0.28
59 0.27
60 0.25
61 0.19
62 0.13
63 0.12
64 0.1
65 0.08
66 0.07
67 0.07
68 0.07
69 0.06
70 0.05
71 0.04
72 0.04
73 0.05
74 0.04
75 0.04
76 0.05
77 0.05
78 0.05
79 0.05
80 0.06
81 0.08
82 0.08
83 0.1
84 0.12
85 0.13
86 0.12
87 0.14
88 0.16
89 0.21
90 0.22
91 0.21
92 0.22
93 0.24
94 0.31
95 0.4
96 0.45
97 0.45
98 0.46
99 0.46
100 0.45
101 0.43
102 0.38
103 0.34
104 0.29
105 0.24
106 0.24
107 0.25
108 0.24
109 0.26
110 0.25
111 0.18