Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5E8BCI2

Protein Details
Accession A0A5E8BCI2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MSRLCKKSKIRKTVKEAAGGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR003958  CBFA_NFYB_domain  
IPR009072  Histone-fold  
Gene Ontology GO:0046982  F:protein heterodimerization activity  
Pfam View protein in Pfam  
PF00808  CBFD_NFYB_HMF  
Amino Acid Sequences MSRLCKKSKIRKTVKEAAGGIPVTEKASTLIYLDYVLFLQKILQEADMEAARMGDKTITSRHIESCLEKSLKSFRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.79
3 0.7
4 0.61
5 0.55
6 0.44
7 0.35
8 0.26
9 0.21
10 0.15
11 0.13
12 0.11
13 0.08
14 0.08
15 0.08
16 0.08
17 0.07
18 0.07
19 0.07
20 0.07
21 0.06
22 0.05
23 0.05
24 0.05
25 0.04
26 0.05
27 0.05
28 0.06
29 0.06
30 0.07
31 0.06
32 0.07
33 0.09
34 0.08
35 0.08
36 0.07
37 0.06
38 0.06
39 0.06
40 0.06
41 0.05
42 0.06
43 0.08
44 0.11
45 0.15
46 0.18
47 0.2
48 0.22
49 0.25
50 0.27
51 0.29
52 0.3
53 0.35
54 0.33
55 0.31
56 0.33