Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5E8BIA6

Protein Details
Accession A0A5E8BIA6    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
44-72LKALHLSSNKTKKKRFSRSQNHKPSKIHGHydrophilic
NLS Segment(s)
PositionSequence
55-59KKKRF
Subcellular Location(s) nucl 15.5, cyto_nucl 13.5, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006856  MATalpha_HMGbox  
Gene Ontology GO:0005634  C:nucleus  
GO:0008301  F:DNA binding, bending  
GO:0045895  P:positive regulation of mating-type specific transcription, DNA-templated  
Pfam View protein in Pfam  
PF04769  MATalpha_HMGbox  
PROSITE View protein in PROSITE  
PS51325  ALPHA_BOX  
Amino Acid Sequences MNKVTTYFIDFNAPQEGTESCNHTEELPAIPEMSLDLRSALEQLKALHLSSNKTKKKRFSRSQNHKPSKIHGFTAYKSYYSRNFLSVSQGLISAILSKAWALEKNQHVWDLYAKLYRRYKRNLSFSEWLEKNTVSAESSNFEFDEKIKSLNTSKINPSAMYETFDSSSSSPQISLDMQPANFVDSTLQLSLEVLPSSIHAGSGLPYITTDMSDNSRDFVLHLTPENNTEISNESLDVTLSMISSSSKISSSYNDLLHIFGPEWLQESEYLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.21
4 0.18
5 0.21
6 0.23
7 0.2
8 0.21
9 0.22
10 0.21
11 0.22
12 0.2
13 0.2
14 0.17
15 0.16
16 0.15
17 0.14
18 0.13
19 0.13
20 0.13
21 0.11
22 0.09
23 0.09
24 0.09
25 0.09
26 0.11
27 0.12
28 0.11
29 0.12
30 0.13
31 0.16
32 0.16
33 0.16
34 0.19
35 0.2
36 0.24
37 0.32
38 0.42
39 0.46
40 0.54
41 0.61
42 0.67
43 0.76
44 0.82
45 0.83
46 0.83
47 0.86
48 0.89
49 0.94
50 0.95
51 0.93
52 0.9
53 0.82
54 0.77
55 0.76
56 0.67
57 0.59
58 0.55
59 0.5
60 0.43
61 0.48
62 0.42
63 0.33
64 0.31
65 0.32
66 0.29
67 0.3
68 0.3
69 0.25
70 0.25
71 0.25
72 0.29
73 0.26
74 0.23
75 0.18
76 0.17
77 0.14
78 0.13
79 0.12
80 0.07
81 0.06
82 0.05
83 0.05
84 0.04
85 0.05
86 0.07
87 0.09
88 0.09
89 0.16
90 0.19
91 0.23
92 0.24
93 0.24
94 0.23
95 0.22
96 0.23
97 0.18
98 0.16
99 0.17
100 0.17
101 0.23
102 0.3
103 0.35
104 0.38
105 0.43
106 0.51
107 0.55
108 0.63
109 0.6
110 0.6
111 0.59
112 0.55
113 0.57
114 0.48
115 0.41
116 0.33
117 0.29
118 0.23
119 0.18
120 0.16
121 0.09
122 0.09
123 0.08
124 0.08
125 0.09
126 0.09
127 0.08
128 0.08
129 0.08
130 0.08
131 0.11
132 0.11
133 0.11
134 0.11
135 0.13
136 0.15
137 0.21
138 0.24
139 0.23
140 0.25
141 0.28
142 0.29
143 0.27
144 0.27
145 0.24
146 0.21
147 0.2
148 0.18
149 0.15
150 0.15
151 0.15
152 0.15
153 0.12
154 0.13
155 0.12
156 0.11
157 0.1
158 0.09
159 0.1
160 0.1
161 0.11
162 0.13
163 0.14
164 0.13
165 0.14
166 0.14
167 0.14
168 0.12
169 0.11
170 0.08
171 0.07
172 0.1
173 0.09
174 0.09
175 0.07
176 0.08
177 0.08
178 0.09
179 0.08
180 0.06
181 0.06
182 0.06
183 0.08
184 0.08
185 0.07
186 0.06
187 0.06
188 0.07
189 0.08
190 0.08
191 0.06
192 0.06
193 0.08
194 0.08
195 0.08
196 0.08
197 0.08
198 0.11
199 0.14
200 0.14
201 0.14
202 0.15
203 0.14
204 0.14
205 0.14
206 0.13
207 0.13
208 0.15
209 0.15
210 0.15
211 0.18
212 0.19
213 0.17
214 0.15
215 0.15
216 0.15
217 0.16
218 0.16
219 0.14
220 0.13
221 0.13
222 0.13
223 0.11
224 0.09
225 0.07
226 0.07
227 0.06
228 0.06
229 0.06
230 0.07
231 0.08
232 0.09
233 0.09
234 0.1
235 0.12
236 0.15
237 0.22
238 0.26
239 0.26
240 0.28
241 0.27
242 0.27
243 0.26
244 0.24
245 0.17
246 0.14
247 0.14
248 0.12
249 0.14
250 0.14
251 0.14