Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1UWH1

Protein Details
Accession H1UWH1    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
5-34AVGVQPRTRARQSRNKQKRIKRLLTFQFFSHydrophilic
NLS Segment(s)
PositionSequence
15-25RQSRNKQKRIK
Subcellular Location(s) mito 16, mito_nucl 12.833, nucl 7.5, cyto_nucl 5.666
Family & Domain DBs
KEGG chig:CH63R_07120  -  
Amino Acid Sequences MKFLAVGVQPRTRARQSRNKQKRIKRLLTFQFFSHGSIDDKLTSHTKFNRSPTVVVRMTSEEEKKVVKKSDHTTYKKAKRLSRNAVSAVRSRFVHGSHDYIDLENTDLRKNLM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.59
3 0.66
4 0.73
5 0.81
6 0.85
7 0.87
8 0.89
9 0.91
10 0.91
11 0.9
12 0.86
13 0.85
14 0.85
15 0.82
16 0.74
17 0.64
18 0.57
19 0.48
20 0.42
21 0.33
22 0.24
23 0.18
24 0.17
25 0.17
26 0.13
27 0.13
28 0.14
29 0.16
30 0.16
31 0.19
32 0.22
33 0.27
34 0.3
35 0.34
36 0.39
37 0.38
38 0.39
39 0.38
40 0.4
41 0.36
42 0.32
43 0.28
44 0.23
45 0.22
46 0.23
47 0.21
48 0.15
49 0.15
50 0.17
51 0.18
52 0.21
53 0.24
54 0.23
55 0.29
56 0.34
57 0.42
58 0.5
59 0.53
60 0.57
61 0.63
62 0.7
63 0.7
64 0.72
65 0.7
66 0.7
67 0.75
68 0.77
69 0.74
70 0.7
71 0.69
72 0.67
73 0.62
74 0.58
75 0.5
76 0.44
77 0.36
78 0.34
79 0.31
80 0.27
81 0.3
82 0.26
83 0.27
84 0.26
85 0.28
86 0.26
87 0.25
88 0.25
89 0.19
90 0.18
91 0.17
92 0.17
93 0.16