Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5E8BX80

Protein Details
Accession A0A5E8BX80    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
81-113KYWIFNKKSKGYRKSAHRQSKWTRITNRVPPEHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, mito_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGRMFGPFRATMPALGGLLWKNPHTMSKFQKSRHRLRMRTVDAVLENLQKGLDAVNQRCLTLQKMISNTPKESDMLPRDKYWIFNKKSKGYRKSAHRQSKWTRITNRVPPEHF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.16
3 0.16
4 0.16
5 0.12
6 0.14
7 0.15
8 0.14
9 0.14
10 0.15
11 0.2
12 0.23
13 0.3
14 0.35
15 0.44
16 0.5
17 0.56
18 0.65
19 0.68
20 0.74
21 0.77
22 0.79
23 0.73
24 0.75
25 0.78
26 0.74
27 0.7
28 0.6
29 0.52
30 0.42
31 0.39
32 0.32
33 0.23
34 0.17
35 0.12
36 0.11
37 0.08
38 0.08
39 0.07
40 0.08
41 0.11
42 0.12
43 0.19
44 0.19
45 0.19
46 0.2
47 0.21
48 0.19
49 0.19
50 0.2
51 0.16
52 0.18
53 0.22
54 0.28
55 0.3
56 0.29
57 0.27
58 0.26
59 0.24
60 0.22
61 0.26
62 0.26
63 0.29
64 0.3
65 0.29
66 0.32
67 0.32
68 0.36
69 0.37
70 0.41
71 0.41
72 0.45
73 0.52
74 0.58
75 0.66
76 0.71
77 0.71
78 0.7
79 0.73
80 0.77
81 0.8
82 0.82
83 0.84
84 0.81
85 0.83
86 0.84
87 0.86
88 0.84
89 0.83
90 0.79
91 0.77
92 0.8
93 0.8
94 0.8