Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5E8BM46

Protein Details
Accession A0A5E8BM46    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
16-41AMAGGKKSKKKWSKGKVKDKAQHHVIBasic
NLS Segment(s)
PositionSequence
11-35AKAAAAMAGGKKSKKKWSKGKVKDK
Subcellular Location(s) mito 14.5, mito_nucl 10, cyto 8, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MPPKIQQSKAAKAAAAMAGGKKSKKKWSKGKVKDKAQHHVILDQPLYDRIFKEAATYKLVSVSVLVDRLKIGGSLARVALRDLEEQGVIKPVIKHSKQYTFTRATASE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.27
3 0.2
4 0.14
5 0.16
6 0.19
7 0.22
8 0.25
9 0.3
10 0.39
11 0.47
12 0.56
13 0.63
14 0.71
15 0.79
16 0.84
17 0.9
18 0.9
19 0.91
20 0.89
21 0.84
22 0.82
23 0.75
24 0.69
25 0.58
26 0.52
27 0.43
28 0.39
29 0.32
30 0.24
31 0.2
32 0.17
33 0.17
34 0.14
35 0.12
36 0.11
37 0.11
38 0.11
39 0.13
40 0.15
41 0.16
42 0.18
43 0.18
44 0.16
45 0.17
46 0.17
47 0.14
48 0.1
49 0.09
50 0.07
51 0.09
52 0.09
53 0.08
54 0.08
55 0.08
56 0.08
57 0.07
58 0.07
59 0.06
60 0.07
61 0.08
62 0.09
63 0.1
64 0.1
65 0.11
66 0.12
67 0.12
68 0.12
69 0.12
70 0.12
71 0.12
72 0.12
73 0.12
74 0.14
75 0.12
76 0.14
77 0.14
78 0.2
79 0.3
80 0.31
81 0.38
82 0.42
83 0.51
84 0.56
85 0.6
86 0.62
87 0.58
88 0.58