Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5E8B9L0

Protein Details
Accession A0A5E8B9L0    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
279-305PLSTSHVEARKRRNKSRYPNHPFPESWHydrophilic
NLS Segment(s)
PositionSequence
289-293KRRNK
Subcellular Location(s) mito 15, nucl 10.5, cyto_nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039848  Ribosomal_S24/S35  
IPR019349  Ribosomal_S24/S35_mit  
IPR017081  Ribosomal_S24_mit  
Gene Ontology GO:0005763  C:mitochondrial small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF10213  MRP-S28  
Amino Acid Sequences MAIQTLFRRALRPSAIRNFSQSAVRANELSPEEVLQQGFRKMREMPNYKKSEEELKPLLTAAKALGISEASLRDIYQRTTVENTGKSSSKKSSGDSASSPGASKSPATGFVPGSKAEEQFLLQKLNTNMPIQNAHFPFKYDDIPSLGHLQLRDHRVQREYNRIAAYELPQLAKFASEYKPPTESEVLRFRYTTYMGEDHAGEAKVVVTFKTSDLTELNDKQRHKLRLLAGPRYDHTTDTIKMSSSAFPEAAQNVRYLGDIINSLVSEAKDLSDSFEDIPLSTSHVEARKRRNKSRYPNHPFPESWKRPQDAPKSKSDAFTKLVDQYAQLPKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.57
3 0.56
4 0.59
5 0.55
6 0.49
7 0.47
8 0.4
9 0.36
10 0.35
11 0.35
12 0.31
13 0.28
14 0.32
15 0.29
16 0.28
17 0.22
18 0.2
19 0.19
20 0.19
21 0.2
22 0.16
23 0.17
24 0.22
25 0.25
26 0.25
27 0.27
28 0.3
29 0.37
30 0.45
31 0.52
32 0.54
33 0.61
34 0.66
35 0.64
36 0.62
37 0.57
38 0.56
39 0.51
40 0.49
41 0.44
42 0.39
43 0.38
44 0.36
45 0.35
46 0.24
47 0.21
48 0.14
49 0.13
50 0.11
51 0.11
52 0.11
53 0.09
54 0.09
55 0.1
56 0.1
57 0.08
58 0.09
59 0.09
60 0.12
61 0.14
62 0.15
63 0.18
64 0.18
65 0.19
66 0.23
67 0.26
68 0.27
69 0.28
70 0.3
71 0.29
72 0.32
73 0.31
74 0.32
75 0.33
76 0.35
77 0.35
78 0.34
79 0.38
80 0.38
81 0.4
82 0.37
83 0.36
84 0.31
85 0.29
86 0.27
87 0.19
88 0.16
89 0.14
90 0.12
91 0.11
92 0.1
93 0.13
94 0.14
95 0.16
96 0.16
97 0.18
98 0.19
99 0.18
100 0.2
101 0.19
102 0.18
103 0.16
104 0.16
105 0.14
106 0.16
107 0.17
108 0.16
109 0.14
110 0.18
111 0.19
112 0.21
113 0.22
114 0.2
115 0.19
116 0.19
117 0.22
118 0.19
119 0.25
120 0.23
121 0.24
122 0.23
123 0.23
124 0.23
125 0.22
126 0.23
127 0.17
128 0.16
129 0.16
130 0.16
131 0.16
132 0.17
133 0.16
134 0.15
135 0.14
136 0.15
137 0.18
138 0.21
139 0.24
140 0.24
141 0.26
142 0.28
143 0.33
144 0.35
145 0.41
146 0.39
147 0.38
148 0.36
149 0.33
150 0.31
151 0.27
152 0.24
153 0.17
154 0.16
155 0.13
156 0.12
157 0.12
158 0.11
159 0.1
160 0.09
161 0.09
162 0.1
163 0.13
164 0.15
165 0.17
166 0.19
167 0.19
168 0.22
169 0.23
170 0.22
171 0.23
172 0.29
173 0.3
174 0.29
175 0.29
176 0.26
177 0.25
178 0.25
179 0.21
180 0.17
181 0.15
182 0.15
183 0.16
184 0.15
185 0.13
186 0.14
187 0.13
188 0.09
189 0.08
190 0.08
191 0.08
192 0.08
193 0.07
194 0.06
195 0.07
196 0.08
197 0.1
198 0.09
199 0.1
200 0.1
201 0.13
202 0.17
203 0.21
204 0.28
205 0.31
206 0.32
207 0.37
208 0.44
209 0.45
210 0.41
211 0.43
212 0.41
213 0.45
214 0.51
215 0.53
216 0.48
217 0.47
218 0.47
219 0.46
220 0.41
221 0.33
222 0.3
223 0.27
224 0.24
225 0.25
226 0.24
227 0.19
228 0.19
229 0.2
230 0.19
231 0.17
232 0.17
233 0.14
234 0.14
235 0.15
236 0.17
237 0.17
238 0.16
239 0.14
240 0.13
241 0.13
242 0.13
243 0.12
244 0.1
245 0.09
246 0.09
247 0.09
248 0.09
249 0.08
250 0.08
251 0.09
252 0.09
253 0.09
254 0.09
255 0.09
256 0.09
257 0.09
258 0.12
259 0.12
260 0.14
261 0.13
262 0.15
263 0.15
264 0.14
265 0.15
266 0.12
267 0.14
268 0.13
269 0.13
270 0.15
271 0.21
272 0.28
273 0.34
274 0.45
275 0.52
276 0.61
277 0.7
278 0.76
279 0.81
280 0.85
281 0.89
282 0.89
283 0.9
284 0.91
285 0.86
286 0.82
287 0.73
288 0.71
289 0.71
290 0.68
291 0.67
292 0.65
293 0.63
294 0.63
295 0.71
296 0.74
297 0.73
298 0.7
299 0.7
300 0.69
301 0.69
302 0.69
303 0.64
304 0.58
305 0.51
306 0.5
307 0.45
308 0.41
309 0.41
310 0.34
311 0.31
312 0.33