Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5E8AYI6

Protein Details
Accession A0A5E8AYI6    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPKKRANNGRSKKGRGHVSSBasic
89-112REGRRIRTPPPRVRYNKDGKKINPBasic
NLS Segment(s)
PositionSequence
3-15KKRANNGRSKKGR
87-108RSREGRRIRTPPPRVRYNKDGK
Subcellular Location(s) mito 16.5, mito_nucl 12, nucl 6.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MPKKRANNGRSKKGRGHVSSIRCSNCARMVPKDKAIKRYLIRNMVEAAAIRDISEQSVYTEYVLPKLYLKIHYCVSCAIHSKVVRVRSREGRRIRTPPPRVRYNKDGKKINPTVASKAVY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.74
3 0.72
4 0.69
5 0.67
6 0.69
7 0.68
8 0.61
9 0.54
10 0.5
11 0.46
12 0.42
13 0.41
14 0.36
15 0.38
16 0.44
17 0.47
18 0.53
19 0.59
20 0.58
21 0.59
22 0.58
23 0.57
24 0.52
25 0.56
26 0.55
27 0.54
28 0.5
29 0.44
30 0.43
31 0.35
32 0.33
33 0.24
34 0.18
35 0.11
36 0.1
37 0.08
38 0.07
39 0.07
40 0.07
41 0.07
42 0.06
43 0.06
44 0.07
45 0.07
46 0.07
47 0.09
48 0.09
49 0.1
50 0.11
51 0.1
52 0.1
53 0.11
54 0.13
55 0.15
56 0.17
57 0.18
58 0.21
59 0.21
60 0.22
61 0.22
62 0.22
63 0.2
64 0.22
65 0.21
66 0.23
67 0.23
68 0.26
69 0.29
70 0.35
71 0.38
72 0.37
73 0.43
74 0.47
75 0.56
76 0.61
77 0.65
78 0.66
79 0.7
80 0.73
81 0.76
82 0.76
83 0.78
84 0.78
85 0.78
86 0.79
87 0.79
88 0.8
89 0.81
90 0.81
91 0.81
92 0.8
93 0.81
94 0.76
95 0.78
96 0.76
97 0.73
98 0.7
99 0.64
100 0.61