Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5E8BRM8

Protein Details
Accession A0A5E8BRM8    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-57LNDPCQSMVRKVRKARKARKARKARKARKARRVHKARKVHRGHKGHKGHKDHKNCMBasic
NLS Segment(s)
PositionSequence
11-52RKVRKARKARKARKARKARKARRVHKARKVHRGHKGHKGHKD
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, mito 5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MLNDPCQSMVRKVRKARKARKARKARKARKARRVHKARKVHRGHKGHKGHKDHKNCMDRMDRMDRNDGLVSKELKSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.81
3 0.85
4 0.86
5 0.88
6 0.9
7 0.91
8 0.92
9 0.93
10 0.93
11 0.94
12 0.93
13 0.93
14 0.93
15 0.93
16 0.92
17 0.92
18 0.9
19 0.9
20 0.9
21 0.89
22 0.88
23 0.88
24 0.85
25 0.85
26 0.84
27 0.81
28 0.8
29 0.8
30 0.75
31 0.75
32 0.77
33 0.75
34 0.75
35 0.77
36 0.76
37 0.76
38 0.8
39 0.78
40 0.78
41 0.78
42 0.7
43 0.66
44 0.64
45 0.58
46 0.56
47 0.57
48 0.52
49 0.47
50 0.52
51 0.46
52 0.43
53 0.43
54 0.37
55 0.31
56 0.32
57 0.31