Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5E8BEJ4

Protein Details
Accession A0A5E8BEJ4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
50-71TPPDPFPKGKPDFRKKESRNEKBasic
NLS Segment(s)
PositionSequence
58-70GKPDFRKKESRNE
Subcellular Location(s) extr 13, mito 6, E.R. 6
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVFKKRLFAAYLVAGALLIFLLYGLNNYYAFHHYYGLEAAGSPDMSIGVTPPDPFPKGKPDFRKKESRNEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.12
3 0.1
4 0.06
5 0.03
6 0.02
7 0.02
8 0.02
9 0.02
10 0.03
11 0.04
12 0.05
13 0.05
14 0.06
15 0.08
16 0.09
17 0.11
18 0.11
19 0.11
20 0.11
21 0.11
22 0.11
23 0.09
24 0.07
25 0.06
26 0.06
27 0.05
28 0.05
29 0.04
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.05
36 0.06
37 0.07
38 0.09
39 0.12
40 0.14
41 0.16
42 0.18
43 0.27
44 0.33
45 0.42
46 0.51
47 0.59
48 0.67
49 0.73
50 0.82
51 0.77