Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VN78

Protein Details
Accession H1VN78    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
120-144GNGKVRPAKKAKPARAPPQPRQNTAHydrophilic
NLS Segment(s)
PositionSequence
123-138GKVRPAKKAKPARAPP
Subcellular Location(s) nucl 13.5, cyto_nucl 10, cyto 5.5, mito 3, pero 3
Family & Domain DBs
Amino Acid Sequences MTDQLKDPLPTSVDDFGTDERISFSKLDNKYLAVLDDGTELEFDPATSTWTEPADVPLDPFNDEDETAAQLADLSRAGAGPGYINGXGPQQTNSRKRKDSPTSAEDGGRINAAQGEAGGNGNGKVRPAKKAKPARAPPQPRQNTAXYXTGLCATPPRRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.2
4 0.22
5 0.21
6 0.17
7 0.16
8 0.16
9 0.17
10 0.15
11 0.17
12 0.22
13 0.24
14 0.28
15 0.27
16 0.27
17 0.28
18 0.27
19 0.25
20 0.17
21 0.16
22 0.12
23 0.11
24 0.1
25 0.08
26 0.08
27 0.07
28 0.07
29 0.06
30 0.06
31 0.06
32 0.06
33 0.07
34 0.08
35 0.08
36 0.09
37 0.1
38 0.1
39 0.09
40 0.11
41 0.11
42 0.1
43 0.11
44 0.11
45 0.12
46 0.12
47 0.12
48 0.11
49 0.1
50 0.1
51 0.1
52 0.08
53 0.08
54 0.08
55 0.07
56 0.06
57 0.05
58 0.05
59 0.05
60 0.04
61 0.04
62 0.03
63 0.03
64 0.04
65 0.03
66 0.03
67 0.03
68 0.03
69 0.05
70 0.05
71 0.05
72 0.06
73 0.07
74 0.07
75 0.08
76 0.15
77 0.21
78 0.31
79 0.37
80 0.43
81 0.47
82 0.51
83 0.6
84 0.61
85 0.63
86 0.6
87 0.59
88 0.58
89 0.55
90 0.52
91 0.42
92 0.35
93 0.26
94 0.19
95 0.14
96 0.09
97 0.08
98 0.08
99 0.07
100 0.05
101 0.06
102 0.06
103 0.06
104 0.06
105 0.06
106 0.06
107 0.09
108 0.09
109 0.1
110 0.16
111 0.18
112 0.26
113 0.34
114 0.41
115 0.49
116 0.59
117 0.67
118 0.72
119 0.79
120 0.81
121 0.84
122 0.86
123 0.86
124 0.86
125 0.85
126 0.79
127 0.74
128 0.67
129 0.61
130 0.57
131 0.51
132 0.41
133 0.36
134 0.32
135 0.29
136 0.32