Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VA59

Protein Details
Accession H1VA59    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
87-112EWIPKLCWRAWPKKRMRTTTRPVTCPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 3, plas 3, extr 2, cyto_nucl 2
Family & Domain DBs
Amino Acid Sequences MVSIYICVPCRVHLAAAVPTIWPGTRHPTRGYRQKGTEESRVAGVGVHNSCKSQVRIVCSVRVFGLLRCDSHCYGMAWHDTRRCGAEWIPKLCWRAWPKKRMRTTTRPVTCPTQAMWLKPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.22
4 0.21
5 0.16
6 0.16
7 0.16
8 0.14
9 0.12
10 0.11
11 0.19
12 0.23
13 0.27
14 0.32
15 0.4
16 0.48
17 0.57
18 0.62
19 0.61
20 0.61
21 0.64
22 0.67
23 0.64
24 0.62
25 0.54
26 0.47
27 0.4
28 0.36
29 0.29
30 0.21
31 0.16
32 0.14
33 0.12
34 0.13
35 0.12
36 0.13
37 0.14
38 0.16
39 0.17
40 0.17
41 0.19
42 0.21
43 0.27
44 0.28
45 0.31
46 0.28
47 0.28
48 0.23
49 0.23
50 0.19
51 0.13
52 0.18
53 0.15
54 0.15
55 0.16
56 0.2
57 0.18
58 0.19
59 0.2
60 0.14
61 0.14
62 0.16
63 0.2
64 0.18
65 0.21
66 0.22
67 0.22
68 0.23
69 0.24
70 0.23
71 0.2
72 0.22
73 0.28
74 0.33
75 0.36
76 0.38
77 0.4
78 0.42
79 0.4
80 0.45
81 0.44
82 0.48
83 0.53
84 0.6
85 0.66
86 0.74
87 0.83
88 0.84
89 0.85
90 0.85
91 0.86
92 0.86
93 0.84
94 0.78
95 0.73
96 0.7
97 0.64
98 0.56
99 0.47
100 0.46
101 0.41