Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5E3XLZ0

Protein Details
Accession A0A5E3XLZ0    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
97-121AWQASWAPRGERRRRRRWIRRSRGSHydrophilic
NLS Segment(s)
PositionSequence
104-121PRGERRRRRRWIRRSRGS
Subcellular Location(s) nucl 12, mito 8, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016161  Ald_DH/histidinol_DH  
IPR016162  Ald_DH_N  
IPR012394  Aldehyde_DH_NAD(P)  
Gene Ontology GO:0016491  F:oxidoreductase activity  
GO:0006081  P:cellular aldehyde metabolic process  
Amino Acid Sequences MISSTPDEISNAYARIQSTFTSGKTRPLAWRRQQLVQIGKLVQENEEMLLSAISVDLGKPRVEVMVADMGPVVSFVVEALEKLEEWAAPESVDDVPAWQASWAPRGERRRRRRWIRRSRGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.17
4 0.15
5 0.17
6 0.19
7 0.2
8 0.25
9 0.25
10 0.31
11 0.32
12 0.35
13 0.39
14 0.45
15 0.53
16 0.55
17 0.64
18 0.61
19 0.63
20 0.64
21 0.62
22 0.6
23 0.53
24 0.47
25 0.38
26 0.35
27 0.31
28 0.27
29 0.2
30 0.15
31 0.13
32 0.1
33 0.09
34 0.08
35 0.06
36 0.05
37 0.05
38 0.04
39 0.03
40 0.03
41 0.03
42 0.03
43 0.04
44 0.05
45 0.06
46 0.06
47 0.06
48 0.06
49 0.06
50 0.06
51 0.07
52 0.09
53 0.09
54 0.09
55 0.09
56 0.09
57 0.08
58 0.08
59 0.06
60 0.02
61 0.02
62 0.02
63 0.03
64 0.03
65 0.03
66 0.04
67 0.05
68 0.05
69 0.05
70 0.06
71 0.05
72 0.07
73 0.09
74 0.08
75 0.08
76 0.08
77 0.09
78 0.09
79 0.1
80 0.08
81 0.07
82 0.08
83 0.08
84 0.08
85 0.07
86 0.09
87 0.1
88 0.15
89 0.16
90 0.19
91 0.27
92 0.37
93 0.48
94 0.57
95 0.66
96 0.72
97 0.81
98 0.89
99 0.92
100 0.93
101 0.94