Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5E3X5P4

Protein Details
Accession A0A5E3X5P4    Localization Confidence Low Confidence Score 5.4
NoLS Segment(s)
PositionSequenceProtein Nature
54-75PEPVPRSYPLPQRQRRPVQGYEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, plas 4, E.R. 2, nucl 1, cyto 1, extr 1, cyto_nucl 1, golg 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR039961  Nuo9.5  
Gene Ontology GO:0016020  C:membrane  
CDD cd22903  NI9M  
Amino Acid Sequences MASAGTPISRTLRYMRWAAHEKPALFFAVAIASTAPVFMVVGNALKSSGKYVAPEPVPRSYPLPQRQRRPVQGYEDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.31
3 0.35
4 0.41
5 0.42
6 0.46
7 0.46
8 0.43
9 0.4
10 0.39
11 0.32
12 0.25
13 0.22
14 0.14
15 0.09
16 0.08
17 0.07
18 0.05
19 0.05
20 0.05
21 0.05
22 0.04
23 0.03
24 0.03
25 0.03
26 0.03
27 0.03
28 0.04
29 0.04
30 0.04
31 0.05
32 0.05
33 0.05
34 0.07
35 0.09
36 0.09
37 0.1
38 0.12
39 0.17
40 0.2
41 0.25
42 0.27
43 0.29
44 0.3
45 0.31
46 0.34
47 0.34
48 0.41
49 0.46
50 0.54
51 0.58
52 0.66
53 0.75
54 0.81
55 0.84
56 0.81
57 0.78