Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q8SQQ7

Protein Details
Accession Q8SQQ7   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
74-118PVSKLPKELRPKLNRSKRRALTKTQLRRKTRRQRARMSKFPRVIFHydrophilic
NLS Segment(s)
PositionSequence
77-112KLPKELRPKLNRSKRRALTKTQLRRKTRRQRARMSK
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
KEGG ecu:ECU11_2060  -  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
Amino Acid Sequences MKIEASALRQLGIKQIEERAAEIKAELAALRQKKNSGDVGANDIKTAKKNLARALTVRREKILEELVEAYRGTPVSKLPKELRPKLNRSKRRALTKTQLRRKTRRQRARMSKFPRVIFAYNE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.24
3 0.27
4 0.26
5 0.27
6 0.22
7 0.2
8 0.18
9 0.16
10 0.14
11 0.1
12 0.1
13 0.08
14 0.08
15 0.14
16 0.19
17 0.22
18 0.23
19 0.26
20 0.27
21 0.3
22 0.31
23 0.28
24 0.26
25 0.24
26 0.29
27 0.3
28 0.28
29 0.25
30 0.23
31 0.21
32 0.19
33 0.2
34 0.18
35 0.18
36 0.21
37 0.26
38 0.29
39 0.29
40 0.31
41 0.37
42 0.41
43 0.42
44 0.39
45 0.35
46 0.32
47 0.3
48 0.3
49 0.25
50 0.16
51 0.13
52 0.14
53 0.13
54 0.13
55 0.13
56 0.11
57 0.08
58 0.09
59 0.08
60 0.06
61 0.1
62 0.18
63 0.19
64 0.25
65 0.28
66 0.35
67 0.44
68 0.52
69 0.59
70 0.59
71 0.67
72 0.73
73 0.8
74 0.81
75 0.8
76 0.83
77 0.81
78 0.83
79 0.8
80 0.78
81 0.78
82 0.79
83 0.82
84 0.82
85 0.83
86 0.82
87 0.86
88 0.88
89 0.89
90 0.89
91 0.89
92 0.89
93 0.9
94 0.93
95 0.93
96 0.93
97 0.9
98 0.9
99 0.87
100 0.79
101 0.74
102 0.68