Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5E3W7S2

Protein Details
Accession A0A5E3W7S2    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
161-186LNGAPSAKRRGRPKGSRNKKLGEGEPBasic
NLS Segment(s)
PositionSequence
166-181SAKRRGRPKGSRNKKL
Subcellular Location(s) nucl 20, cyto_nucl 14, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR018482  Znf-C4H2  
Amino Acid Sequences MNGDGKSQADWTKSLVQLARNAELKKNALALQIHTAHILAAHASLDAKEQEIQDVKEQKNKLDSERARLLACLVEVNADRDKMDMKALQIEDECSELRKRIDTIKDGEYIAAKTDVDKLREELGHPPLQSLQSLLDEKSQQYLQERLAESAAKRTADEASLNGAPSAKRRGRPKGSRNKKLGEGEPSSANS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.31
4 0.35
5 0.38
6 0.39
7 0.38
8 0.39
9 0.38
10 0.4
11 0.39
12 0.34
13 0.33
14 0.29
15 0.28
16 0.28
17 0.26
18 0.28
19 0.28
20 0.26
21 0.24
22 0.22
23 0.17
24 0.16
25 0.14
26 0.07
27 0.06
28 0.05
29 0.05
30 0.05
31 0.06
32 0.07
33 0.07
34 0.08
35 0.1
36 0.1
37 0.13
38 0.15
39 0.17
40 0.22
41 0.29
42 0.29
43 0.34
44 0.35
45 0.34
46 0.38
47 0.38
48 0.36
49 0.38
50 0.39
51 0.39
52 0.44
53 0.43
54 0.37
55 0.35
56 0.32
57 0.22
58 0.2
59 0.13
60 0.08
61 0.08
62 0.08
63 0.1
64 0.11
65 0.1
66 0.1
67 0.1
68 0.11
69 0.09
70 0.11
71 0.1
72 0.09
73 0.14
74 0.14
75 0.14
76 0.13
77 0.14
78 0.12
79 0.12
80 0.12
81 0.09
82 0.09
83 0.1
84 0.1
85 0.11
86 0.11
87 0.16
88 0.19
89 0.21
90 0.24
91 0.25
92 0.26
93 0.25
94 0.25
95 0.2
96 0.16
97 0.14
98 0.11
99 0.08
100 0.07
101 0.14
102 0.16
103 0.17
104 0.18
105 0.18
106 0.2
107 0.21
108 0.22
109 0.2
110 0.22
111 0.24
112 0.23
113 0.22
114 0.21
115 0.22
116 0.2
117 0.16
118 0.12
119 0.12
120 0.14
121 0.14
122 0.15
123 0.16
124 0.16
125 0.18
126 0.18
127 0.16
128 0.18
129 0.2
130 0.2
131 0.25
132 0.25
133 0.23
134 0.24
135 0.25
136 0.22
137 0.26
138 0.27
139 0.21
140 0.2
141 0.2
142 0.2
143 0.19
144 0.2
145 0.14
146 0.16
147 0.17
148 0.17
149 0.16
150 0.17
151 0.15
152 0.18
153 0.27
154 0.28
155 0.34
156 0.42
157 0.53
158 0.62
159 0.72
160 0.79
161 0.81
162 0.87
163 0.9
164 0.89
165 0.85
166 0.83
167 0.8
168 0.76
169 0.73
170 0.67
171 0.6