Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5E3WZM2

Protein Details
Accession A0A5E3WZM2    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
342-367AGSSGSGHRHHRHRRHSHVGTSRHHSBasic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
Amino Acid Sequences MAFQYYQAAPGWGQQQYQFGTPPPLGYQPDYNWNGLDYYRAHVSSRGGPYDPAFYQNVVSRAGQGGAVGSGYHEAKHWHRRAYGGIAELSRLLPEEVGAAAAYEAWRQFRHTLSHYDYLNPYDRRQEAMHGLAVAEAVRLWQDTGRGYDQYASQLAAEAAAATVGHILRRKMDGGNVLRHGETPADAYYRGRRNSVSGFGGIGDSFMRRRSRSPMPGGVPSYAGSSVSGYASSGGYGGGGSVYGGGGSVVGTPMTAAVPISSSPYGYASSTPMVSGSPISGMPMAMQTGYSQPGAMGYPASATAQYAQAYSGGAQGVYDAGAQMGYPSSYTGSGYQQPVIIAGSSGSGHRHHRHRRHSHVGTSRHHSRSRDYY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.27
3 0.28
4 0.3
5 0.28
6 0.25
7 0.28
8 0.27
9 0.26
10 0.24
11 0.27
12 0.28
13 0.29
14 0.32
15 0.3
16 0.39
17 0.4
18 0.38
19 0.34
20 0.31
21 0.29
22 0.24
23 0.25
24 0.17
25 0.17
26 0.2
27 0.21
28 0.21
29 0.22
30 0.26
31 0.3
32 0.34
33 0.33
34 0.3
35 0.31
36 0.32
37 0.34
38 0.32
39 0.27
40 0.23
41 0.21
42 0.22
43 0.25
44 0.25
45 0.22
46 0.21
47 0.19
48 0.19
49 0.19
50 0.16
51 0.12
52 0.11
53 0.08
54 0.08
55 0.06
56 0.05
57 0.08
58 0.08
59 0.08
60 0.09
61 0.13
62 0.2
63 0.31
64 0.35
65 0.38
66 0.4
67 0.42
68 0.45
69 0.47
70 0.43
71 0.35
72 0.32
73 0.27
74 0.26
75 0.24
76 0.2
77 0.14
78 0.12
79 0.09
80 0.06
81 0.06
82 0.06
83 0.06
84 0.06
85 0.05
86 0.05
87 0.04
88 0.05
89 0.05
90 0.06
91 0.06
92 0.08
93 0.09
94 0.12
95 0.14
96 0.17
97 0.21
98 0.23
99 0.29
100 0.33
101 0.38
102 0.36
103 0.37
104 0.35
105 0.34
106 0.38
107 0.33
108 0.29
109 0.3
110 0.3
111 0.3
112 0.3
113 0.3
114 0.26
115 0.26
116 0.25
117 0.19
118 0.18
119 0.15
120 0.14
121 0.1
122 0.07
123 0.04
124 0.03
125 0.03
126 0.04
127 0.04
128 0.04
129 0.06
130 0.07
131 0.1
132 0.12
133 0.12
134 0.13
135 0.14
136 0.14
137 0.14
138 0.14
139 0.11
140 0.09
141 0.09
142 0.09
143 0.07
144 0.06
145 0.04
146 0.04
147 0.03
148 0.03
149 0.02
150 0.04
151 0.04
152 0.05
153 0.07
154 0.08
155 0.09
156 0.11
157 0.12
158 0.12
159 0.14
160 0.19
161 0.21
162 0.25
163 0.26
164 0.26
165 0.24
166 0.24
167 0.23
168 0.15
169 0.12
170 0.09
171 0.08
172 0.08
173 0.08
174 0.09
175 0.15
176 0.21
177 0.21
178 0.21
179 0.21
180 0.23
181 0.25
182 0.27
183 0.22
184 0.17
185 0.16
186 0.15
187 0.15
188 0.11
189 0.09
190 0.06
191 0.06
192 0.06
193 0.1
194 0.12
195 0.13
196 0.16
197 0.22
198 0.29
199 0.36
200 0.41
201 0.43
202 0.44
203 0.47
204 0.47
205 0.41
206 0.34
207 0.27
208 0.23
209 0.16
210 0.13
211 0.09
212 0.08
213 0.08
214 0.07
215 0.06
216 0.05
217 0.06
218 0.06
219 0.05
220 0.05
221 0.04
222 0.04
223 0.04
224 0.04
225 0.03
226 0.03
227 0.03
228 0.03
229 0.02
230 0.02
231 0.02
232 0.02
233 0.02
234 0.03
235 0.03
236 0.03
237 0.03
238 0.03
239 0.03
240 0.04
241 0.04
242 0.04
243 0.03
244 0.03
245 0.04
246 0.05
247 0.08
248 0.08
249 0.08
250 0.08
251 0.1
252 0.11
253 0.11
254 0.12
255 0.11
256 0.12
257 0.12
258 0.11
259 0.1
260 0.09
261 0.09
262 0.09
263 0.07
264 0.07
265 0.07
266 0.07
267 0.07
268 0.07
269 0.07
270 0.07
271 0.07
272 0.06
273 0.07
274 0.06
275 0.08
276 0.1
277 0.1
278 0.09
279 0.08
280 0.09
281 0.1
282 0.09
283 0.08
284 0.06
285 0.06
286 0.07
287 0.08
288 0.07
289 0.07
290 0.08
291 0.1
292 0.11
293 0.1
294 0.1
295 0.1
296 0.1
297 0.1
298 0.11
299 0.08
300 0.08
301 0.07
302 0.07
303 0.07
304 0.07
305 0.06
306 0.04
307 0.04
308 0.04
309 0.04
310 0.05
311 0.05
312 0.05
313 0.05
314 0.06
315 0.07
316 0.08
317 0.1
318 0.11
319 0.15
320 0.21
321 0.23
322 0.23
323 0.23
324 0.23
325 0.22
326 0.21
327 0.16
328 0.11
329 0.09
330 0.09
331 0.08
332 0.09
333 0.11
334 0.14
335 0.22
336 0.29
337 0.4
338 0.5
339 0.59
340 0.7
341 0.78
342 0.84
343 0.88
344 0.88
345 0.87
346 0.86
347 0.85
348 0.81
349 0.79
350 0.79
351 0.76
352 0.74
353 0.67