Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5E3WTE1

Protein Details
Accession A0A5E3WTE1    Localization Confidence High Confidence Score 17
NoLS Segment(s)
PositionSequenceProtein Nature
2-26FSASSSTYRPLKRRRRTATSVMAGDHydrophilic
69-91AASPEIAKKRRGRPPKARPSAPHBasic
184-210MPPPAPPQPKERKRRESARKGWKGWVEBasic
NLS Segment(s)
PositionSequence
75-90AKKRRGRPPKARPSAP
190-206PQPKERKRRESARKGWK
Subcellular Location(s) mito 16.5, mito_nucl 13.333, nucl 9, cyto_nucl 5.833
Family & Domain DBs
Amino Acid Sequences MFSASSSTYRPLKRRRRTATSVMAGDFDPRPRRDVLTSVLNGVPPNPEAENLGWEEKKRPERVIQDIAAASPEIAKKRRGRPPKARPSAPHARLATPISAVAPAAAANPVISTPTPVRPLAGTPFDTTSFGGRTVIQMLSQGRARSLTPPPMPSSPPTTPGPSISSSTSQVSSKRLNTPDDLDMPPPAPPQPKERKRRESARKGWKGWVEISDDEEDTSKRIKLDDPVVILKEKRLRSGREL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.83
3 0.84
4 0.85
5 0.86
6 0.85
7 0.82
8 0.74
9 0.64
10 0.56
11 0.46
12 0.41
13 0.34
14 0.31
15 0.3
16 0.28
17 0.3
18 0.31
19 0.34
20 0.34
21 0.36
22 0.34
23 0.35
24 0.35
25 0.35
26 0.34
27 0.31
28 0.28
29 0.25
30 0.22
31 0.13
32 0.15
33 0.12
34 0.12
35 0.13
36 0.14
37 0.16
38 0.16
39 0.2
40 0.19
41 0.2
42 0.24
43 0.3
44 0.37
45 0.38
46 0.39
47 0.42
48 0.47
49 0.54
50 0.55
51 0.48
52 0.44
53 0.4
54 0.36
55 0.29
56 0.23
57 0.15
58 0.11
59 0.12
60 0.14
61 0.16
62 0.23
63 0.29
64 0.39
65 0.49
66 0.57
67 0.65
68 0.72
69 0.81
70 0.85
71 0.87
72 0.84
73 0.78
74 0.76
75 0.76
76 0.68
77 0.64
78 0.55
79 0.47
80 0.43
81 0.41
82 0.33
83 0.23
84 0.2
85 0.13
86 0.11
87 0.09
88 0.06
89 0.05
90 0.04
91 0.04
92 0.04
93 0.04
94 0.03
95 0.04
96 0.03
97 0.04
98 0.04
99 0.06
100 0.07
101 0.1
102 0.13
103 0.13
104 0.13
105 0.13
106 0.14
107 0.15
108 0.16
109 0.15
110 0.13
111 0.15
112 0.15
113 0.16
114 0.15
115 0.13
116 0.11
117 0.1
118 0.1
119 0.08
120 0.08
121 0.1
122 0.09
123 0.08
124 0.1
125 0.1
126 0.12
127 0.14
128 0.13
129 0.12
130 0.13
131 0.13
132 0.15
133 0.18
134 0.23
135 0.23
136 0.26
137 0.29
138 0.3
139 0.31
140 0.29
141 0.33
142 0.27
143 0.29
144 0.29
145 0.29
146 0.28
147 0.28
148 0.29
149 0.23
150 0.24
151 0.22
152 0.22
153 0.21
154 0.21
155 0.21
156 0.2
157 0.2
158 0.22
159 0.25
160 0.27
161 0.32
162 0.34
163 0.35
164 0.36
165 0.38
166 0.37
167 0.37
168 0.34
169 0.28
170 0.26
171 0.24
172 0.22
173 0.2
174 0.2
175 0.21
176 0.21
177 0.3
178 0.4
179 0.5
180 0.59
181 0.68
182 0.75
183 0.79
184 0.88
185 0.89
186 0.89
187 0.9
188 0.91
189 0.9
190 0.83
191 0.82
192 0.76
193 0.68
194 0.61
195 0.54
196 0.47
197 0.39
198 0.39
199 0.33
200 0.28
201 0.25
202 0.23
203 0.2
204 0.17
205 0.18
206 0.17
207 0.15
208 0.16
209 0.19
210 0.24
211 0.3
212 0.33
213 0.35
214 0.38
215 0.4
216 0.42
217 0.4
218 0.4
219 0.41
220 0.39
221 0.43
222 0.45