Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5E3XMF9

Protein Details
Accession A0A5E3XMF9    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
36-55AEEQRREKRRRDFATKMDKEBasic
NLS Segment(s)
PositionSequence
151-156EKRRRA
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013907  Sds3  
Gene Ontology GO:0005654  C:nucleoplasm  
Amino Acid Sequences MFAVPHSSRTRNGDDYYLHGGSSMGAGPSRSHGASAEEQRREKRRRDFATKMDKEMNDRRGESRTYVDGIQGLHNTSLQLSSRPETSPAFLLRVYPLSLQRSALLVQHELEEHAALEAAQQMFDMERARVEDEYKRGRERVRERMLEGIEEKRRRAREERDGDALGDSAAGGALDAQTRPGATRKLRGKLASPPPQDMPQPAMGAATGAPSNPHSLAIDELPSAFPLPLTAVTLPQSGHQSGQGGAQGQNRRRAKGAGGAPQPAFGMLGKSVLSLTGCKESEIEADLSDITRGNKRRRTAAGGSGNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.43
3 0.45
4 0.39
5 0.32
6 0.27
7 0.24
8 0.19
9 0.19
10 0.15
11 0.08
12 0.09
13 0.1
14 0.1
15 0.13
16 0.17
17 0.15
18 0.15
19 0.15
20 0.19
21 0.26
22 0.35
23 0.4
24 0.43
25 0.48
26 0.56
27 0.65
28 0.67
29 0.69
30 0.7
31 0.72
32 0.75
33 0.79
34 0.8
35 0.8
36 0.84
37 0.79
38 0.74
39 0.71
40 0.63
41 0.61
42 0.61
43 0.58
44 0.52
45 0.5
46 0.47
47 0.44
48 0.45
49 0.4
50 0.35
51 0.31
52 0.28
53 0.26
54 0.24
55 0.22
56 0.2
57 0.2
58 0.17
59 0.16
60 0.14
61 0.13
62 0.13
63 0.11
64 0.12
65 0.1
66 0.12
67 0.13
68 0.14
69 0.16
70 0.17
71 0.19
72 0.18
73 0.19
74 0.21
75 0.19
76 0.19
77 0.17
78 0.18
79 0.17
80 0.17
81 0.16
82 0.15
83 0.17
84 0.19
85 0.2
86 0.19
87 0.18
88 0.18
89 0.18
90 0.18
91 0.15
92 0.13
93 0.12
94 0.13
95 0.12
96 0.11
97 0.1
98 0.08
99 0.06
100 0.06
101 0.05
102 0.04
103 0.04
104 0.07
105 0.06
106 0.06
107 0.06
108 0.06
109 0.06
110 0.07
111 0.08
112 0.05
113 0.06
114 0.07
115 0.08
116 0.09
117 0.11
118 0.13
119 0.18
120 0.25
121 0.27
122 0.28
123 0.3
124 0.32
125 0.4
126 0.43
127 0.48
128 0.49
129 0.48
130 0.47
131 0.49
132 0.47
133 0.39
134 0.34
135 0.29
136 0.29
137 0.28
138 0.28
139 0.29
140 0.3
141 0.33
142 0.38
143 0.39
144 0.43
145 0.47
146 0.5
147 0.48
148 0.47
149 0.43
150 0.36
151 0.29
152 0.18
153 0.11
154 0.08
155 0.04
156 0.03
157 0.02
158 0.02
159 0.02
160 0.02
161 0.03
162 0.03
163 0.04
164 0.04
165 0.04
166 0.05
167 0.08
168 0.13
169 0.15
170 0.24
171 0.3
172 0.35
173 0.39
174 0.4
175 0.4
176 0.44
177 0.52
178 0.54
179 0.49
180 0.47
181 0.46
182 0.46
183 0.44
184 0.36
185 0.3
186 0.22
187 0.2
188 0.17
189 0.15
190 0.12
191 0.12
192 0.1
193 0.08
194 0.05
195 0.05
196 0.06
197 0.06
198 0.09
199 0.09
200 0.1
201 0.09
202 0.1
203 0.11
204 0.11
205 0.11
206 0.09
207 0.1
208 0.09
209 0.09
210 0.09
211 0.07
212 0.06
213 0.06
214 0.07
215 0.07
216 0.09
217 0.09
218 0.09
219 0.11
220 0.13
221 0.12
222 0.13
223 0.16
224 0.15
225 0.15
226 0.15
227 0.15
228 0.14
229 0.16
230 0.16
231 0.14
232 0.17
233 0.22
234 0.29
235 0.32
236 0.41
237 0.43
238 0.43
239 0.44
240 0.43
241 0.39
242 0.4
243 0.42
244 0.42
245 0.43
246 0.45
247 0.43
248 0.42
249 0.39
250 0.3
251 0.24
252 0.15
253 0.14
254 0.09
255 0.1
256 0.09
257 0.1
258 0.09
259 0.1
260 0.1
261 0.09
262 0.12
263 0.18
264 0.18
265 0.18
266 0.19
267 0.19
268 0.2
269 0.22
270 0.2
271 0.13
272 0.14
273 0.14
274 0.14
275 0.13
276 0.13
277 0.13
278 0.2
279 0.28
280 0.37
281 0.44
282 0.48
283 0.56
284 0.61
285 0.67
286 0.65
287 0.67