Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5E3X0P3

Protein Details
Accession A0A5E3X0P3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
12-37CSDGSMRRRCTRRPRRMRHRAGVLVAHydrophilic
NLS Segment(s)
PositionSequence
24-27RPRR
Subcellular Location(s) mito 19.5, mito_nucl 11.333, cyto 3.5, cyto_nucl 3.333
Family & Domain DBs
Amino Acid Sequences MSVLLFLRPVVCSDGSMRRRCTRRPRRMRHRAGVLVALLLDIPSSTEAGDSPTLFHIRRLLISHGLFTYTRMPQLGHNLVVPRRRAQC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.33
3 0.39
4 0.43
5 0.48
6 0.53
7 0.61
8 0.69
9 0.7
10 0.74
11 0.79
12 0.85
13 0.88
14 0.93
15 0.94
16 0.91
17 0.88
18 0.81
19 0.71
20 0.62
21 0.5
22 0.39
23 0.29
24 0.2
25 0.11
26 0.07
27 0.05
28 0.03
29 0.03
30 0.03
31 0.03
32 0.03
33 0.03
34 0.04
35 0.06
36 0.07
37 0.06
38 0.07
39 0.09
40 0.11
41 0.12
42 0.12
43 0.14
44 0.14
45 0.16
46 0.18
47 0.19
48 0.22
49 0.22
50 0.23
51 0.2
52 0.21
53 0.19
54 0.19
55 0.21
56 0.16
57 0.18
58 0.17
59 0.18
60 0.18
61 0.27
62 0.29
63 0.26
64 0.27
65 0.31
66 0.36
67 0.41
68 0.42