Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H1VY80

Protein Details
Accession H1VY80    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
66-90GIPISTSRSKRPKRRRAGSIELGRLHydrophilic
NLS Segment(s)
PositionSequence
73-82RSKRPKRRRA
Subcellular Location(s) mito 18, nucl 4, plas 3, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MVSSSRSMRSIFSRICCMAASEQRAAISEPTYPWVSEAICSRSTSSPSFMFLVWIWRTSRRPVGSGIPISTSRSKRPKRRRAGSIELGRLVAAMTTTLERAFMPSMSVSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.38
3 0.35
4 0.32
5 0.31
6 0.32
7 0.32
8 0.27
9 0.27
10 0.26
11 0.27
12 0.25
13 0.2
14 0.15
15 0.12
16 0.11
17 0.14
18 0.14
19 0.13
20 0.13
21 0.13
22 0.12
23 0.13
24 0.15
25 0.15
26 0.16
27 0.16
28 0.18
29 0.19
30 0.21
31 0.21
32 0.21
33 0.18
34 0.18
35 0.19
36 0.16
37 0.16
38 0.13
39 0.17
40 0.14
41 0.15
42 0.14
43 0.17
44 0.19
45 0.21
46 0.27
47 0.23
48 0.24
49 0.25
50 0.28
51 0.3
52 0.3
53 0.27
54 0.23
55 0.23
56 0.25
57 0.29
58 0.27
59 0.3
60 0.39
61 0.48
62 0.56
63 0.67
64 0.74
65 0.79
66 0.86
67 0.87
68 0.86
69 0.86
70 0.85
71 0.82
72 0.76
73 0.66
74 0.57
75 0.47
76 0.37
77 0.28
78 0.18
79 0.09
80 0.05
81 0.05
82 0.06
83 0.07
84 0.07
85 0.08
86 0.08
87 0.1
88 0.11
89 0.1
90 0.12