Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H1UZR3

Protein Details
Accession H1UZR3    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
380-399WKHTNFRTTPRRRHEAARVRBasic
NLS Segment(s)
Subcellular Location(s) cyto 13.5, cyto_nucl 11.5, nucl 8.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000269  Cu_amine_oxidase  
IPR015798  Cu_amine_oxidase_C  
IPR036460  Cu_amine_oxidase_C_sf  
IPR016182  Cu_amine_oxidase_N-reg  
IPR015800  Cu_amine_oxidase_N2  
Gene Ontology GO:0005507  F:copper ion binding  
GO:0008131  F:primary amine oxidase activity  
GO:0048038  F:quinone binding  
GO:0009308  P:amine metabolic process  
Pfam View protein in Pfam  
PF01179  Cu_amine_oxid  
PF02727  Cu_amine_oxidN2  
Amino Acid Sequences MAPHPLTALSRDEFKTARDIVTNLYGSDSSLFYRAIFLQEPKKAELVPFLQAEHAGTITDETPRPPRLARLQYDVIRTSKLPEHTQSVVDLGSGKEVDRTVAGPHSHPGYLPDEFALFQDACVASQLFKDAMADFSLPEGFTVTIDPWPYGGPDEGEDIPSYMQGLVFARDASKDNLDSNHYGYPIPIIPVMDFTTKEIVRIDRLATGGAGDGLNPRPPSSKPRPLFVNARSSASSEYVPELLDMPQRADLKPINITQPEGASFRVHADNLVEWQKXRXRLGFTPREGAVLHDLCYDGRPVLYRLSYSELTVPYGDPRXPFQRKQAFDLGDGGFGRVANNLELGCDCLGAIHYLDALLADTEGNPTIAKAVACLHEQDNGIGWKHTNFRTTPRRRHEAARVRCPVRRHAGQLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.33
3 0.3
4 0.3
5 0.27
6 0.27
7 0.27
8 0.32
9 0.31
10 0.25
11 0.25
12 0.22
13 0.2
14 0.21
15 0.18
16 0.13
17 0.14
18 0.14
19 0.12
20 0.15
21 0.15
22 0.17
23 0.19
24 0.23
25 0.29
26 0.34
27 0.37
28 0.37
29 0.38
30 0.35
31 0.33
32 0.34
33 0.29
34 0.29
35 0.26
36 0.25
37 0.24
38 0.23
39 0.23
40 0.17
41 0.14
42 0.09
43 0.08
44 0.09
45 0.09
46 0.12
47 0.12
48 0.15
49 0.2
50 0.23
51 0.25
52 0.25
53 0.31
54 0.38
55 0.46
56 0.47
57 0.49
58 0.54
59 0.56
60 0.59
61 0.56
62 0.47
63 0.41
64 0.37
65 0.33
66 0.31
67 0.32
68 0.32
69 0.31
70 0.35
71 0.35
72 0.35
73 0.32
74 0.27
75 0.23
76 0.18
77 0.16
78 0.11
79 0.1
80 0.1
81 0.09
82 0.1
83 0.1
84 0.1
85 0.1
86 0.11
87 0.11
88 0.15
89 0.16
90 0.16
91 0.18
92 0.2
93 0.19
94 0.18
95 0.19
96 0.19
97 0.18
98 0.17
99 0.16
100 0.14
101 0.14
102 0.14
103 0.14
104 0.1
105 0.09
106 0.12
107 0.12
108 0.11
109 0.12
110 0.12
111 0.09
112 0.09
113 0.11
114 0.07
115 0.07
116 0.08
117 0.07
118 0.08
119 0.09
120 0.09
121 0.07
122 0.08
123 0.09
124 0.08
125 0.07
126 0.07
127 0.06
128 0.06
129 0.07
130 0.07
131 0.08
132 0.09
133 0.09
134 0.08
135 0.08
136 0.08
137 0.09
138 0.08
139 0.07
140 0.07
141 0.11
142 0.1
143 0.11
144 0.11
145 0.1
146 0.09
147 0.09
148 0.08
149 0.05
150 0.05
151 0.05
152 0.06
153 0.07
154 0.07
155 0.07
156 0.07
157 0.08
158 0.1
159 0.11
160 0.12
161 0.12
162 0.12
163 0.14
164 0.17
165 0.17
166 0.17
167 0.17
168 0.16
169 0.15
170 0.14
171 0.14
172 0.11
173 0.11
174 0.09
175 0.08
176 0.07
177 0.09
178 0.1
179 0.1
180 0.09
181 0.1
182 0.13
183 0.13
184 0.14
185 0.13
186 0.13
187 0.13
188 0.14
189 0.14
190 0.11
191 0.11
192 0.1
193 0.09
194 0.08
195 0.07
196 0.06
197 0.05
198 0.04
199 0.06
200 0.06
201 0.09
202 0.09
203 0.1
204 0.11
205 0.13
206 0.22
207 0.29
208 0.38
209 0.37
210 0.41
211 0.45
212 0.47
213 0.53
214 0.48
215 0.49
216 0.4
217 0.41
218 0.37
219 0.34
220 0.31
221 0.25
222 0.22
223 0.13
224 0.13
225 0.11
226 0.1
227 0.09
228 0.09
229 0.09
230 0.1
231 0.1
232 0.1
233 0.14
234 0.15
235 0.15
236 0.18
237 0.18
238 0.18
239 0.21
240 0.22
241 0.22
242 0.21
243 0.22
244 0.2
245 0.19
246 0.19
247 0.16
248 0.15
249 0.12
250 0.11
251 0.13
252 0.14
253 0.13
254 0.12
255 0.12
256 0.11
257 0.14
258 0.22
259 0.21
260 0.2
261 0.23
262 0.27
263 0.27
264 0.3
265 0.31
266 0.33
267 0.37
268 0.44
269 0.48
270 0.45
271 0.45
272 0.42
273 0.38
274 0.35
275 0.3
276 0.23
277 0.17
278 0.16
279 0.15
280 0.16
281 0.15
282 0.08
283 0.08
284 0.09
285 0.1
286 0.13
287 0.14
288 0.14
289 0.15
290 0.2
291 0.2
292 0.19
293 0.22
294 0.19
295 0.2
296 0.2
297 0.18
298 0.16
299 0.22
300 0.21
301 0.2
302 0.27
303 0.34
304 0.35
305 0.44
306 0.48
307 0.46
308 0.51
309 0.58
310 0.53
311 0.46
312 0.49
313 0.41
314 0.36
315 0.32
316 0.27
317 0.18
318 0.16
319 0.15
320 0.11
321 0.12
322 0.09
323 0.1
324 0.09
325 0.1
326 0.1
327 0.11
328 0.1
329 0.09
330 0.08
331 0.07
332 0.08
333 0.08
334 0.08
335 0.06
336 0.06
337 0.06
338 0.06
339 0.06
340 0.06
341 0.05
342 0.05
343 0.05
344 0.05
345 0.07
346 0.07
347 0.08
348 0.07
349 0.07
350 0.08
351 0.1
352 0.09
353 0.09
354 0.12
355 0.14
356 0.16
357 0.19
358 0.19
359 0.21
360 0.22
361 0.22
362 0.23
363 0.23
364 0.23
365 0.22
366 0.22
367 0.22
368 0.28
369 0.31
370 0.32
371 0.31
372 0.4
373 0.5
374 0.59
375 0.66
376 0.69
377 0.74
378 0.73
379 0.79
380 0.8
381 0.8
382 0.8
383 0.8
384 0.8
385 0.77
386 0.77
387 0.73
388 0.71
389 0.7
390 0.67