Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5E3XEH7

Protein Details
Accession A0A5E3XEH7    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
184-210GLKGAGCARRNRRRSRSASRRTCKKRABasic
NLS Segment(s)
PositionSequence
192-210RRNRRRSRSASRRTCKKRA
Subcellular Location(s) extr 11, plas 7, mito 3, nucl 2, E.R. 2, cyto_mito 2
Family & Domain DBs
Amino Acid Sequences MSAVSTLAALPPHYIVLGMGVVTFFTYEMPAYVHAALAVAFIGTLMIIQALSPDESDEAAPEPEQEEVLSDKPPTTVPEQESTPKSPAAARAAAIEMTVNVPPPSPSTSASSESESSSAYSVNSSAPTSAGFSFSSLPSTPRTPNTPGSARRTAFVRQLQRRSHILVDLSSRSRSLKSTPILVGLKGAGCARRNRRRSRSASRRTCKKRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.08
4 0.08
5 0.07
6 0.06
7 0.05
8 0.05
9 0.05
10 0.06
11 0.04
12 0.04
13 0.05
14 0.05
15 0.06
16 0.07
17 0.08
18 0.1
19 0.1
20 0.1
21 0.09
22 0.09
23 0.08
24 0.07
25 0.06
26 0.04
27 0.03
28 0.03
29 0.03
30 0.03
31 0.02
32 0.02
33 0.02
34 0.02
35 0.02
36 0.03
37 0.04
38 0.05
39 0.05
40 0.05
41 0.06
42 0.07
43 0.07
44 0.07
45 0.08
46 0.08
47 0.08
48 0.08
49 0.08
50 0.07
51 0.08
52 0.07
53 0.07
54 0.08
55 0.09
56 0.1
57 0.1
58 0.1
59 0.1
60 0.11
61 0.13
62 0.14
63 0.17
64 0.19
65 0.21
66 0.23
67 0.27
68 0.3
69 0.3
70 0.29
71 0.24
72 0.22
73 0.21
74 0.22
75 0.2
76 0.18
77 0.15
78 0.14
79 0.15
80 0.14
81 0.13
82 0.09
83 0.06
84 0.06
85 0.06
86 0.06
87 0.05
88 0.05
89 0.06
90 0.07
91 0.09
92 0.1
93 0.11
94 0.14
95 0.17
96 0.2
97 0.21
98 0.22
99 0.2
100 0.19
101 0.18
102 0.15
103 0.13
104 0.1
105 0.09
106 0.07
107 0.06
108 0.06
109 0.06
110 0.07
111 0.07
112 0.07
113 0.07
114 0.07
115 0.09
116 0.08
117 0.09
118 0.08
119 0.09
120 0.1
121 0.1
122 0.13
123 0.11
124 0.12
125 0.13
126 0.17
127 0.18
128 0.2
129 0.25
130 0.26
131 0.3
132 0.35
133 0.39
134 0.42
135 0.47
136 0.51
137 0.47
138 0.45
139 0.43
140 0.4
141 0.41
142 0.42
143 0.45
144 0.46
145 0.55
146 0.57
147 0.59
148 0.59
149 0.56
150 0.5
151 0.43
152 0.36
153 0.3
154 0.3
155 0.3
156 0.29
157 0.26
158 0.25
159 0.24
160 0.24
161 0.24
162 0.23
163 0.26
164 0.27
165 0.31
166 0.31
167 0.36
168 0.36
169 0.34
170 0.31
171 0.25
172 0.22
173 0.19
174 0.2
175 0.18
176 0.2
177 0.3
178 0.39
179 0.48
180 0.57
181 0.67
182 0.74
183 0.8
184 0.86
185 0.88
186 0.89
187 0.89
188 0.91
189 0.91
190 0.93