Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5E3X8X7

Protein Details
Accession A0A5E3X8X7    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
101-123GLKGAVKVKDKPKPKPDSKDTKKBasic
NLS Segment(s)
PositionSequence
92-123RGPPKHPVNGLKGAVKVKDKPKPKPDSKDTKK
Subcellular Location(s) nucl 16.5, cyto_nucl 12.333, cyto 5, cyto_pero 3.499, mito 3
Family & Domain DBs
Amino Acid Sequences MTETKVDNPGEPRQGTSDVPVEGDRASAGDRPALGHEPSAPTVGSYETEHTQGTALEKDLYGGGDEGNSSDLESSGSSSESSSEDDSGYRSRGPPKHPVNGLKGAVKVKDKPKPKPDSKDTKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.34
3 0.32
4 0.29
5 0.22
6 0.23
7 0.21
8 0.18
9 0.15
10 0.15
11 0.11
12 0.08
13 0.09
14 0.1
15 0.1
16 0.1
17 0.1
18 0.11
19 0.14
20 0.16
21 0.15
22 0.13
23 0.14
24 0.15
25 0.16
26 0.16
27 0.13
28 0.1
29 0.11
30 0.11
31 0.11
32 0.09
33 0.11
34 0.11
35 0.12
36 0.12
37 0.11
38 0.11
39 0.1
40 0.1
41 0.09
42 0.08
43 0.08
44 0.08
45 0.08
46 0.08
47 0.07
48 0.06
49 0.05
50 0.04
51 0.04
52 0.04
53 0.04
54 0.05
55 0.04
56 0.04
57 0.04
58 0.04
59 0.05
60 0.05
61 0.06
62 0.05
63 0.06
64 0.06
65 0.06
66 0.07
67 0.07
68 0.09
69 0.09
70 0.1
71 0.1
72 0.1
73 0.12
74 0.13
75 0.13
76 0.13
77 0.15
78 0.23
79 0.28
80 0.33
81 0.41
82 0.46
83 0.53
84 0.58
85 0.61
86 0.6
87 0.62
88 0.6
89 0.53
90 0.5
91 0.45
92 0.43
93 0.42
94 0.43
95 0.44
96 0.5
97 0.56
98 0.62
99 0.69
100 0.75
101 0.8
102 0.83
103 0.85