Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5E3XN98

Protein Details
Accession A0A5E3XN98    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
44-67SRDPPVYSKPKQPQPPQQDSRPSSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 13, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR037202  ESCRT_assembly_dom  
IPR017916  SB_dom  
IPR016135  UBQ-conjugating_enzyme/RWD  
IPR008883  UEV_N  
Gene Ontology GO:0005768  C:endosome  
GO:0072666  P:establishment of protein localization to vacuole  
GO:0006886  P:intracellular protein transport  
GO:0036211  P:protein modification process  
GO:0043162  P:ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway  
GO:0007034  P:vacuolar transport  
Pfam View protein in Pfam  
PF09454  Vps23_core  
PROSITE View protein in PROSITE  
PS51312  SB  
PS51322  UEV  
Amino Acid Sequences MLVKPGKYMDVSGRCNIEYLQNWARKSEGCHLLALVEEMRSHFSRDPPVYSKPKQPQPPQQDSRPSSLPSSPPASAQSLDQRPALPPKPPSSASSPPLLQPVLSSAQPPFSHHPSNSTPVQSANPSSSPRYQSPALPPKPPTAAFPHVQPLQHHSHSSYTPHHEHSRSASVVGSPAQLSAHPAPLAPAPGPASAVQQRWSLPPAGPTPASPPSVPYQQTPAPAPIYAPAPAVPSGPPPGAYAYTTAAAPTPAQSVVPALAQPVIPAPNLLDEDDDSGSAPTPAPNQAPPRPPNPELLRLHEQVRNKLAGELASLAHAHALDAERLRAHQRDLLAGEPAIRDESARLTAVRDVCGGVAARLRGAVQAAEANVAELRRKGDPPVDELVCAPSIVHNQLIDLVAEDNAIEDTIYHLHRALNAGRIDLDRFLRTTRSLAEEQFMKRALVEKIQTALPASRSGWS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.4
3 0.38
4 0.35
5 0.29
6 0.32
7 0.37
8 0.39
9 0.4
10 0.4
11 0.42
12 0.37
13 0.4
14 0.42
15 0.41
16 0.37
17 0.38
18 0.37
19 0.35
20 0.32
21 0.29
22 0.2
23 0.12
24 0.11
25 0.11
26 0.16
27 0.16
28 0.2
29 0.21
30 0.24
31 0.33
32 0.35
33 0.41
34 0.41
35 0.5
36 0.55
37 0.57
38 0.63
39 0.63
40 0.69
41 0.73
42 0.78
43 0.79
44 0.8
45 0.86
46 0.83
47 0.82
48 0.83
49 0.77
50 0.74
51 0.67
52 0.59
53 0.52
54 0.5
55 0.44
56 0.38
57 0.4
58 0.34
59 0.31
60 0.32
61 0.31
62 0.27
63 0.27
64 0.31
65 0.31
66 0.32
67 0.32
68 0.3
69 0.3
70 0.38
71 0.38
72 0.34
73 0.35
74 0.38
75 0.43
76 0.44
77 0.44
78 0.44
79 0.48
80 0.45
81 0.44
82 0.4
83 0.36
84 0.37
85 0.34
86 0.26
87 0.19
88 0.2
89 0.17
90 0.16
91 0.16
92 0.13
93 0.19
94 0.2
95 0.24
96 0.26
97 0.29
98 0.34
99 0.33
100 0.39
101 0.37
102 0.42
103 0.41
104 0.37
105 0.32
106 0.29
107 0.31
108 0.27
109 0.25
110 0.23
111 0.22
112 0.23
113 0.26
114 0.29
115 0.32
116 0.31
117 0.34
118 0.33
119 0.34
120 0.42
121 0.48
122 0.47
123 0.47
124 0.48
125 0.47
126 0.49
127 0.45
128 0.38
129 0.35
130 0.36
131 0.32
132 0.32
133 0.34
134 0.33
135 0.34
136 0.31
137 0.3
138 0.32
139 0.33
140 0.32
141 0.27
142 0.27
143 0.27
144 0.3
145 0.3
146 0.29
147 0.31
148 0.34
149 0.38
150 0.36
151 0.37
152 0.37
153 0.38
154 0.31
155 0.29
156 0.24
157 0.19
158 0.19
159 0.18
160 0.14
161 0.09
162 0.08
163 0.08
164 0.07
165 0.11
166 0.11
167 0.12
168 0.11
169 0.11
170 0.12
171 0.12
172 0.13
173 0.09
174 0.1
175 0.09
176 0.09
177 0.11
178 0.1
179 0.13
180 0.15
181 0.16
182 0.17
183 0.17
184 0.18
185 0.18
186 0.19
187 0.17
188 0.14
189 0.16
190 0.16
191 0.17
192 0.16
193 0.16
194 0.18
195 0.2
196 0.21
197 0.18
198 0.18
199 0.19
200 0.23
201 0.24
202 0.2
203 0.22
204 0.22
205 0.24
206 0.23
207 0.22
208 0.18
209 0.17
210 0.16
211 0.13
212 0.12
213 0.11
214 0.1
215 0.08
216 0.09
217 0.09
218 0.1
219 0.08
220 0.09
221 0.1
222 0.1
223 0.1
224 0.09
225 0.1
226 0.1
227 0.1
228 0.1
229 0.09
230 0.1
231 0.09
232 0.09
233 0.08
234 0.07
235 0.07
236 0.06
237 0.06
238 0.06
239 0.06
240 0.06
241 0.06
242 0.06
243 0.07
244 0.06
245 0.05
246 0.06
247 0.06
248 0.06
249 0.07
250 0.07
251 0.07
252 0.07
253 0.06
254 0.07
255 0.08
256 0.08
257 0.08
258 0.07
259 0.09
260 0.09
261 0.09
262 0.08
263 0.07
264 0.07
265 0.07
266 0.07
267 0.06
268 0.07
269 0.09
270 0.1
271 0.15
272 0.2
273 0.26
274 0.34
275 0.36
276 0.4
277 0.45
278 0.45
279 0.49
280 0.47
281 0.5
282 0.45
283 0.5
284 0.5
285 0.45
286 0.47
287 0.43
288 0.42
289 0.38
290 0.38
291 0.33
292 0.27
293 0.26
294 0.23
295 0.2
296 0.17
297 0.14
298 0.1
299 0.09
300 0.09
301 0.08
302 0.08
303 0.07
304 0.06
305 0.06
306 0.07
307 0.08
308 0.09
309 0.1
310 0.1
311 0.12
312 0.16
313 0.16
314 0.16
315 0.17
316 0.17
317 0.2
318 0.21
319 0.21
320 0.19
321 0.17
322 0.17
323 0.14
324 0.14
325 0.11
326 0.1
327 0.09
328 0.08
329 0.1
330 0.11
331 0.12
332 0.12
333 0.12
334 0.17
335 0.18
336 0.18
337 0.16
338 0.15
339 0.14
340 0.15
341 0.14
342 0.11
343 0.12
344 0.11
345 0.1
346 0.11
347 0.11
348 0.1
349 0.1
350 0.09
351 0.07
352 0.09
353 0.09
354 0.1
355 0.09
356 0.09
357 0.1
358 0.1
359 0.11
360 0.1
361 0.13
362 0.15
363 0.17
364 0.19
365 0.24
366 0.26
367 0.29
368 0.34
369 0.33
370 0.3
371 0.29
372 0.29
373 0.23
374 0.21
375 0.16
376 0.12
377 0.15
378 0.16
379 0.17
380 0.14
381 0.14
382 0.16
383 0.17
384 0.14
385 0.11
386 0.1
387 0.08
388 0.08
389 0.08
390 0.07
391 0.06
392 0.06
393 0.05
394 0.04
395 0.06
396 0.1
397 0.11
398 0.11
399 0.12
400 0.13
401 0.15
402 0.2
403 0.2
404 0.24
405 0.24
406 0.24
407 0.25
408 0.26
409 0.26
410 0.25
411 0.26
412 0.21
413 0.22
414 0.23
415 0.25
416 0.25
417 0.26
418 0.26
419 0.29
420 0.31
421 0.31
422 0.34
423 0.37
424 0.37
425 0.39
426 0.37
427 0.31
428 0.28
429 0.31
430 0.29
431 0.3
432 0.31
433 0.29
434 0.3
435 0.31
436 0.31
437 0.29
438 0.29
439 0.24
440 0.25