Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5E3X6R6

Protein Details
Accession A0A5E3X6R6    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
5-26VLEPKKRRRATTGRSRNNEPTPHydrophilic
NLS Segment(s)
PositionSequence
9-13KKRRR
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
Amino Acid Sequences MGALVLEPKKRRRATTGRSRNNEPTPASTPGPSPAPRSHTETPKPYQQQQQPSGSYRPYKGRETPEAGSSGPNQSQKPSLPESTDGVPNRVVDEDYDEGVAEMLIGRLPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.74
3 0.78
4 0.79
5 0.8
6 0.83
7 0.81
8 0.76
9 0.71
10 0.62
11 0.57
12 0.51
13 0.49
14 0.44
15 0.36
16 0.32
17 0.29
18 0.31
19 0.26
20 0.26
21 0.26
22 0.29
23 0.31
24 0.38
25 0.41
26 0.44
27 0.49
28 0.5
29 0.5
30 0.53
31 0.55
32 0.52
33 0.55
34 0.53
35 0.56
36 0.55
37 0.56
38 0.5
39 0.49
40 0.47
41 0.42
42 0.38
43 0.32
44 0.33
45 0.32
46 0.33
47 0.36
48 0.39
49 0.41
50 0.43
51 0.42
52 0.37
53 0.34
54 0.31
55 0.27
56 0.22
57 0.2
58 0.19
59 0.21
60 0.2
61 0.2
62 0.23
63 0.23
64 0.26
65 0.28
66 0.27
67 0.26
68 0.27
69 0.28
70 0.28
71 0.33
72 0.29
73 0.27
74 0.26
75 0.24
76 0.23
77 0.21
78 0.19
79 0.12
80 0.17
81 0.17
82 0.16
83 0.16
84 0.14
85 0.14
86 0.13
87 0.12
88 0.07
89 0.05
90 0.04