Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5E3X7L3

Protein Details
Accession A0A5E3X7L3    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
8-45RNPLSGPDRERRRPARDKPAPYDRKKTGPKPQAHKTSABasic
NLS Segment(s)
PositionSequence
15-50DRERRRPARDKPAPYDRKKTGPKPQAHKTSAKPVGP
Subcellular Location(s) nucl 12, cyto 7, mito_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
Amino Acid Sequences MSDPGEPRNPLSGPDRERRRPARDKPAPYDRKKTGPKPQAHKTSAKPVGPQKKENLTLGDWLEVVAYADAHPGITQPAIELYFKTRPEGALQLSQPSISRNLSAKGRAALEKRRLSHANALDMKRGRFVVRPDVDHALWIWQQSMEERGETPDGNMLVAKRTKFEELFDVPANERMTSRGWLSGFTKACVLHS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.55
3 0.57
4 0.67
5 0.72
6 0.76
7 0.78
8 0.81
9 0.83
10 0.83
11 0.84
12 0.83
13 0.86
14 0.86
15 0.83
16 0.83
17 0.77
18 0.77
19 0.77
20 0.77
21 0.77
22 0.76
23 0.78
24 0.77
25 0.82
26 0.82
27 0.78
28 0.76
29 0.7
30 0.71
31 0.69
32 0.62
33 0.59
34 0.58
35 0.63
36 0.62
37 0.62
38 0.57
39 0.57
40 0.59
41 0.55
42 0.49
43 0.39
44 0.37
45 0.33
46 0.27
47 0.2
48 0.16
49 0.13
50 0.1
51 0.09
52 0.05
53 0.04
54 0.04
55 0.04
56 0.04
57 0.04
58 0.04
59 0.04
60 0.05
61 0.04
62 0.04
63 0.04
64 0.05
65 0.06
66 0.07
67 0.07
68 0.1
69 0.15
70 0.15
71 0.16
72 0.16
73 0.15
74 0.17
75 0.19
76 0.17
77 0.17
78 0.17
79 0.17
80 0.17
81 0.16
82 0.15
83 0.13
84 0.13
85 0.09
86 0.11
87 0.11
88 0.13
89 0.15
90 0.16
91 0.16
92 0.16
93 0.17
94 0.19
95 0.22
96 0.27
97 0.33
98 0.37
99 0.37
100 0.41
101 0.41
102 0.4
103 0.44
104 0.4
105 0.4
106 0.4
107 0.4
108 0.4
109 0.41
110 0.38
111 0.32
112 0.3
113 0.24
114 0.22
115 0.24
116 0.28
117 0.29
118 0.31
119 0.33
120 0.36
121 0.35
122 0.31
123 0.28
124 0.21
125 0.19
126 0.17
127 0.14
128 0.1
129 0.1
130 0.11
131 0.14
132 0.11
133 0.12
134 0.12
135 0.14
136 0.15
137 0.15
138 0.14
139 0.15
140 0.14
141 0.13
142 0.14
143 0.12
144 0.16
145 0.19
146 0.19
147 0.18
148 0.21
149 0.25
150 0.25
151 0.27
152 0.28
153 0.28
154 0.32
155 0.33
156 0.32
157 0.29
158 0.34
159 0.33
160 0.26
161 0.23
162 0.21
163 0.21
164 0.21
165 0.22
166 0.21
167 0.2
168 0.23
169 0.25
170 0.32
171 0.31
172 0.29
173 0.31