Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5E3WRA9

Protein Details
Accession A0A5E3WRA9    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
186-209GSSPSKRERERAPRPRDRGRIHVCBasic
NLS Segment(s)
PositionSequence
163-205PRKRPSKLKVRERVDDRSKRRRSGSSPSKRERERAPRPRDRGR
Subcellular Location(s) nucl 21, cyto_nucl 14.5, cyto 6
Family & Domain DBs
Amino Acid Sequences MQYDALNSMDIDVGYPSPGYAWPSFLGAPVGVESEKPAFDLEREVCSNFTCCGLILPDMHALVDHFEETHVFAPKPEHTRLYVLPEDRPPAPLPRLVIPFPRFLTPPPADRVPVSYDSPSSPLWSDGLPSPVIPSDYLPSYLEQPHASPSSSHPPAFFSPNAPRKRPSKLKVRERVDDRSKRRRSGSSPSKRERERAPRPRDRGRIHVCPHPDCVKTYLNPNGLKYHVEKGTCQAQDGSAIERIEVLQYSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.08
4 0.08
5 0.09
6 0.13
7 0.13
8 0.15
9 0.15
10 0.17
11 0.18
12 0.17
13 0.17
14 0.13
15 0.13
16 0.11
17 0.12
18 0.09
19 0.09
20 0.11
21 0.11
22 0.11
23 0.11
24 0.12
25 0.11
26 0.11
27 0.18
28 0.17
29 0.21
30 0.23
31 0.23
32 0.23
33 0.23
34 0.25
35 0.19
36 0.18
37 0.13
38 0.11
39 0.11
40 0.12
41 0.12
42 0.11
43 0.12
44 0.13
45 0.12
46 0.12
47 0.11
48 0.1
49 0.09
50 0.09
51 0.07
52 0.06
53 0.06
54 0.07
55 0.08
56 0.11
57 0.12
58 0.12
59 0.12
60 0.16
61 0.21
62 0.26
63 0.27
64 0.26
65 0.25
66 0.29
67 0.3
68 0.33
69 0.32
70 0.29
71 0.29
72 0.29
73 0.3
74 0.27
75 0.28
76 0.23
77 0.23
78 0.23
79 0.21
80 0.21
81 0.23
82 0.26
83 0.25
84 0.3
85 0.28
86 0.3
87 0.29
88 0.29
89 0.25
90 0.22
91 0.29
92 0.24
93 0.25
94 0.26
95 0.26
96 0.25
97 0.24
98 0.26
99 0.21
100 0.22
101 0.2
102 0.17
103 0.17
104 0.16
105 0.18
106 0.16
107 0.14
108 0.11
109 0.1
110 0.1
111 0.09
112 0.1
113 0.08
114 0.1
115 0.09
116 0.08
117 0.08
118 0.08
119 0.09
120 0.08
121 0.07
122 0.07
123 0.08
124 0.09
125 0.09
126 0.1
127 0.11
128 0.12
129 0.13
130 0.12
131 0.12
132 0.14
133 0.14
134 0.14
135 0.13
136 0.15
137 0.23
138 0.25
139 0.25
140 0.22
141 0.24
142 0.26
143 0.29
144 0.26
145 0.22
146 0.29
147 0.37
148 0.42
149 0.42
150 0.44
151 0.45
152 0.54
153 0.59
154 0.57
155 0.59
156 0.64
157 0.72
158 0.78
159 0.8
160 0.79
161 0.75
162 0.78
163 0.77
164 0.77
165 0.75
166 0.76
167 0.77
168 0.74
169 0.74
170 0.71
171 0.67
172 0.68
173 0.7
174 0.71
175 0.74
176 0.76
177 0.8
178 0.76
179 0.75
180 0.74
181 0.74
182 0.74
183 0.74
184 0.76
185 0.78
186 0.82
187 0.87
188 0.87
189 0.81
190 0.81
191 0.78
192 0.77
193 0.71
194 0.7
195 0.67
196 0.6
197 0.6
198 0.56
199 0.49
200 0.42
201 0.43
202 0.41
203 0.37
204 0.41
205 0.43
206 0.44
207 0.46
208 0.46
209 0.45
210 0.41
211 0.43
212 0.38
213 0.38
214 0.35
215 0.34
216 0.32
217 0.34
218 0.41
219 0.38
220 0.36
221 0.3
222 0.26
223 0.29
224 0.29
225 0.27
226 0.23
227 0.22
228 0.2
229 0.2
230 0.19
231 0.16