Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VMT0

Protein Details
Accession H1VMT0    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
48-70IVVGEDGRRRRRKRRETAPEIENBasic
NLS Segment(s)
PositionSequence
55-62RRRRRKRR
Subcellular Location(s) mito 14, cyto 6, nucl 2, plas 2, extr 1, pero 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016757  F:glycosyltransferase activity  
KEGG chig:CH63R_07791  -  
Amino Acid Sequences MPPHPLHPRSRMTSTLFATTVVASFFVVGMPHLLPCPAPRVTYADGEIVVGEDGRRRRRKRRETAPEIENGIVNFSQAGDEDTIRTREERLKRECPVPKPGGILGEWLGFHGPSKDAEATKAER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.48
3 0.41
4 0.34
5 0.31
6 0.26
7 0.2
8 0.14
9 0.11
10 0.07
11 0.07
12 0.06
13 0.06
14 0.05
15 0.05
16 0.06
17 0.06
18 0.06
19 0.07
20 0.07
21 0.07
22 0.08
23 0.12
24 0.12
25 0.12
26 0.13
27 0.18
28 0.2
29 0.21
30 0.22
31 0.18
32 0.17
33 0.16
34 0.15
35 0.1
36 0.07
37 0.06
38 0.04
39 0.07
40 0.12
41 0.2
42 0.3
43 0.35
44 0.45
45 0.56
46 0.67
47 0.74
48 0.81
49 0.83
50 0.83
51 0.85
52 0.77
53 0.69
54 0.6
55 0.5
56 0.39
57 0.28
58 0.2
59 0.13
60 0.1
61 0.07
62 0.05
63 0.05
64 0.05
65 0.06
66 0.06
67 0.06
68 0.07
69 0.09
70 0.11
71 0.11
72 0.12
73 0.13
74 0.2
75 0.28
76 0.35
77 0.41
78 0.47
79 0.5
80 0.59
81 0.64
82 0.61
83 0.63
84 0.58
85 0.53
86 0.49
87 0.46
88 0.4
89 0.32
90 0.29
91 0.21
92 0.19
93 0.17
94 0.14
95 0.13
96 0.11
97 0.12
98 0.11
99 0.11
100 0.1
101 0.15
102 0.18
103 0.18
104 0.21