FuNGI

A0A5E3XP39

Protein Details

Accession

A0A5E3XP39

Localization Confidence

High

Confidence Score

16.1

NoLS Segment(s)

Position	Sequence	Protein Nature
29-60	PTSLPSKPATSKPDRRPRKPKPPPEPIRLNDL	Hydrophilic

NLS Segment(s)

Position	Sequence
39-52	SKPDRRPRKPKPPP

Subcellular Location(s)

nucl 22, cyto 5

Family & Domain DBs

InterPro	View protein in InterPro IPR043519 NT_sf IPR002058 PAP_assoc IPR045862 Trf4-like
Gene Ontology	GO:0031499 C:TRAMP complex GO:0046872 F:metal ion binding GO:1990817 F:poly(A) RNA polymerase activity GO:0043631 P:RNA polyadenylation
Pfam	View protein in Pfam PF03828 PAP_assoc
CDD	cd05402 NT_PAP_TUTase

Amino Acid Sequences

MNMPNSGTATDPILVEDGSHPEANSVTLPTSLPSKPATSKPDRRPRKPKPPPEPIRLNDLHAPWLETIPSSSRTSAERMLHEEIAAYQAYMAPTPAERTLRETVTHRLVASIKGRLRDARVYTYGSSATGLSLPKGDIDMVLQSGSSNDEQGNKSKLFQLRNTLTRDGVAAQAFVVTRARHMVMNVECPAHLGSYKADISINSMDGVDAVALINDHAVQWPAIRPLVMFLKGLLALHKLGSAASSGLSSYATISMVISFLQVNPYGLPQASIKDPIKTHSLGTLLLQLLQYYTSDFPYETSYISVREGAVLSKETKAFNPPRQQSDALVIECMVNPDIDIARAAGRMKQVRELFAETRRTFQEGLVAVQTAIDAGVLSGSVLKKVLGVSQELLDYRMRVTQLVASRQHLRDDTLPQSRRDSYQPYSGGSGPRGGPQGGSLLNRIGGYSHTGSSYRSRDDRDDKRSYSYQSARPYGSESLNQGRYSSGYSGGYSGYGRR

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.13
2	0.13
3	0.13
4	0.15
5	0.17
6	0.18
7	0.17
8	0.17
9	0.17
10	0.17
11	0.17
12	0.14
13	0.11
14	0.12
15	0.12
16	0.13
17	0.17
18	0.17
19	0.18
20	0.19
21	0.23
22	0.27
23	0.35
24	0.43
25	0.48
26	0.58
27	0.66
28	0.75
29	0.81
30	0.86
31	0.9
32	0.92
33	0.93
34	0.94
35	0.94
36	0.94
37	0.95
38	0.93
39	0.91
40	0.91
41	0.81
42	0.8
43	0.7
44	0.64
45	0.59
46	0.51
47	0.45
48	0.36
49	0.35
50	0.27
51	0.26
52	0.21
53	0.16
54	0.17
55	0.16
56	0.19
57	0.19
58	0.19
59	0.2
60	0.22
61	0.25
62	0.3
63	0.31
64	0.31
65	0.34
66	0.37
67	0.36
68	0.33
69	0.3
70	0.23
71	0.21
72	0.17
73	0.12
74	0.08
75	0.09
76	0.1
77	0.09
78	0.09
79	0.08
80	0.08
81	0.11
82	0.15
83	0.16
84	0.16
85	0.22
86	0.26
87	0.27
88	0.3
89	0.3
90	0.33
91	0.36
92	0.37
93	0.31
94	0.29
95	0.29
96	0.31
97	0.31
98	0.32
99	0.29
100	0.3
101	0.32
102	0.33
103	0.36
104	0.37
105	0.38
106	0.36
107	0.36
108	0.37
109	0.35
110	0.34
111	0.3
112	0.23
113	0.2
114	0.15
115	0.12
116	0.11
117	0.11
118	0.09
119	0.1
120	0.1
121	0.09
122	0.09
123	0.09
124	0.07
125	0.07
126	0.08
127	0.07
128	0.07
129	0.07
130	0.06
131	0.06
132	0.08
133	0.08
134	0.08
135	0.08
136	0.13
137	0.15
138	0.19
139	0.23
140	0.21
141	0.22
142	0.27
143	0.32
144	0.32
145	0.34
146	0.39
147	0.41
148	0.46
149	0.5
150	0.45
151	0.4
152	0.36
153	0.33
154	0.25
155	0.22
156	0.16
157	0.11
158	0.09
159	0.1
160	0.1
161	0.09
162	0.11
163	0.08
164	0.09
165	0.1
166	0.12
167	0.11
168	0.11
169	0.17
170	0.16
171	0.2
172	0.21
173	0.19
174	0.18
175	0.19
176	0.19
177	0.13
178	0.11
179	0.08
180	0.07
181	0.11
182	0.11
183	0.11
184	0.11
185	0.1
186	0.13
187	0.14
188	0.13
189	0.1
190	0.1
191	0.09
192	0.08
193	0.08
194	0.05
195	0.04
196	0.03
197	0.03
198	0.03
199	0.03
200	0.03
201	0.03
202	0.03
203	0.03
204	0.04
205	0.04
206	0.05
207	0.06
208	0.07
209	0.08
210	0.07
211	0.07
212	0.09
213	0.11
214	0.12
215	0.1
216	0.09
217	0.1
218	0.1
219	0.1
220	0.09
221	0.07
222	0.07
223	0.07
224	0.07
225	0.06
226	0.06
227	0.06
228	0.06
229	0.04
230	0.04
231	0.04
232	0.04
233	0.04
234	0.04
235	0.04
236	0.04
237	0.04
238	0.04
239	0.04
240	0.04
241	0.04
242	0.04
243	0.04
244	0.04
245	0.04
246	0.04
247	0.05
248	0.05
249	0.06
250	0.06
251	0.06
252	0.06
253	0.06
254	0.07
255	0.06
256	0.08
257	0.09
258	0.14
259	0.14
260	0.17
261	0.17
262	0.19
263	0.22
264	0.21
265	0.2
266	0.17
267	0.17
268	0.14
269	0.14
270	0.16
271	0.12
272	0.12
273	0.12
274	0.1
275	0.09
276	0.09
277	0.08
278	0.06
279	0.07
280	0.07
281	0.07
282	0.07
283	0.08
284	0.11
285	0.12
286	0.1
287	0.11
288	0.11
289	0.12
290	0.12
291	0.12
292	0.09
293	0.09
294	0.09
295	0.08
296	0.09
297	0.1
298	0.1
299	0.12
300	0.13
301	0.14
302	0.14
303	0.22
304	0.28
305	0.34
306	0.43
307	0.45
308	0.49
309	0.53
310	0.53
311	0.46
312	0.45
313	0.41
314	0.31
315	0.27
316	0.22
317	0.17
318	0.16
319	0.16
320	0.1
321	0.06
322	0.06
323	0.07
324	0.07
325	0.06
326	0.06
327	0.06
328	0.07
329	0.08
330	0.09
331	0.1
332	0.16
333	0.2
334	0.21
335	0.28
336	0.29
337	0.3
338	0.32
339	0.35
340	0.33
341	0.35
342	0.43
343	0.36
344	0.38
345	0.37
346	0.37
347	0.32
348	0.29
349	0.29
350	0.2
351	0.22
352	0.19
353	0.18
354	0.15
355	0.14
356	0.14
357	0.07
358	0.06
359	0.04
360	0.03
361	0.02
362	0.03
363	0.02
364	0.03
365	0.06
366	0.06
367	0.06
368	0.07
369	0.07
370	0.08
371	0.09
372	0.12
373	0.1
374	0.12
375	0.13
376	0.14
377	0.16
378	0.15
379	0.16
380	0.14
381	0.13
382	0.12
383	0.14
384	0.13
385	0.12
386	0.13
387	0.17
388	0.22
389	0.28
390	0.31
391	0.32
392	0.39
393	0.4
394	0.43
395	0.38
396	0.36
397	0.34
398	0.36
399	0.4
400	0.42
401	0.45
402	0.43
403	0.48
404	0.47
405	0.46
406	0.46
407	0.45
408	0.39
409	0.44
410	0.43
411	0.4
412	0.41
413	0.41
414	0.38
415	0.33
416	0.33
417	0.25
418	0.27
419	0.27
420	0.24
421	0.21
422	0.18
423	0.21
424	0.2
425	0.21
426	0.18
427	0.17
428	0.18
429	0.18
430	0.17
431	0.14
432	0.12
433	0.16
434	0.16
435	0.16
436	0.17
437	0.17
438	0.2
439	0.27
440	0.31
441	0.32
442	0.34
443	0.38
444	0.45
445	0.55
446	0.62
447	0.64
448	0.68
449	0.64
450	0.67
451	0.67
452	0.64
453	0.64
454	0.62
455	0.6
456	0.6
457	0.63
458	0.57
459	0.53
460	0.52
461	0.47
462	0.43
463	0.39
464	0.37
465	0.4
466	0.43
467	0.42
468	0.38
469	0.34
470	0.32
471	0.32
472	0.28
473	0.23
474	0.19
475	0.2
476	0.2
477	0.19
478	0.19

A0A5E3XP39

3D AlphaFold-predicted Structure Viewer