Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5E3XP39

Protein Details
Accession A0A5E3XP39    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
29-60PTSLPSKPATSKPDRRPRKPKPPPEPIRLNDLHydrophilic
NLS Segment(s)
PositionSequence
39-52SKPDRRPRKPKPPP
Subcellular Location(s) nucl 22, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR043519  NT_sf  
IPR002058  PAP_assoc  
IPR045862  Trf4-like  
Gene Ontology GO:0031499  C:TRAMP complex  
GO:0046872  F:metal ion binding  
GO:1990817  F:poly(A) RNA polymerase activity  
GO:0043631  P:RNA polyadenylation  
Pfam View protein in Pfam  
PF03828  PAP_assoc  
CDD cd05402  NT_PAP_TUTase  
Amino Acid Sequences MNMPNSGTATDPILVEDGSHPEANSVTLPTSLPSKPATSKPDRRPRKPKPPPEPIRLNDLHAPWLETIPSSSRTSAERMLHEEIAAYQAYMAPTPAERTLRETVTHRLVASIKGRLRDARVYTYGSSATGLSLPKGDIDMVLQSGSSNDEQGNKSKLFQLRNTLTRDGVAAQAFVVTRARHMVMNVECPAHLGSYKADISINSMDGVDAVALINDHAVQWPAIRPLVMFLKGLLALHKLGSAASSGLSSYATISMVISFLQVNPYGLPQASIKDPIKTHSLGTLLLQLLQYYTSDFPYETSYISVREGAVLSKETKAFNPPRQQSDALVIECMVNPDIDIARAAGRMKQVRELFAETRRTFQEGLVAVQTAIDAGVLSGSVLKKVLGVSQELLDYRMRVTQLVASRQHLRDDTLPQSRRDSYQPYSGGSGPRGGPQGGSLLNRIGGYSHTGSSYRSRDDRDDKRSYSYQSARPYGSESLNQGRYSSGYSGGYSGYGRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.13
4 0.15
5 0.17
6 0.18
7 0.17
8 0.17
9 0.17
10 0.17
11 0.17
12 0.14
13 0.11
14 0.12
15 0.12
16 0.13
17 0.17
18 0.17
19 0.18
20 0.19
21 0.23
22 0.27
23 0.35
24 0.43
25 0.48
26 0.58
27 0.66
28 0.75
29 0.81
30 0.86
31 0.9
32 0.92
33 0.93
34 0.94
35 0.94
36 0.94
37 0.95
38 0.93
39 0.91
40 0.91
41 0.81
42 0.8
43 0.7
44 0.64
45 0.59
46 0.51
47 0.45
48 0.36
49 0.35
50 0.27
51 0.26
52 0.21
53 0.16
54 0.17
55 0.16
56 0.19
57 0.19
58 0.19
59 0.2
60 0.22
61 0.25
62 0.3
63 0.31
64 0.31
65 0.34
66 0.37
67 0.36
68 0.33
69 0.3
70 0.23
71 0.21
72 0.17
73 0.12
74 0.08
75 0.09
76 0.1
77 0.09
78 0.09
79 0.08
80 0.08
81 0.11
82 0.15
83 0.16
84 0.16
85 0.22
86 0.26
87 0.27
88 0.3
89 0.3
90 0.33
91 0.36
92 0.37
93 0.31
94 0.29
95 0.29
96 0.31
97 0.31
98 0.32
99 0.29
100 0.3
101 0.32
102 0.33
103 0.36
104 0.37
105 0.38
106 0.36
107 0.36
108 0.37
109 0.35
110 0.34
111 0.3
112 0.23
113 0.2
114 0.15
115 0.12
116 0.11
117 0.11
118 0.09
119 0.1
120 0.1
121 0.09
122 0.09
123 0.09
124 0.07
125 0.07
126 0.08
127 0.07
128 0.07
129 0.07
130 0.06
131 0.06
132 0.08
133 0.08
134 0.08
135 0.08
136 0.13
137 0.15
138 0.19
139 0.23
140 0.21
141 0.22
142 0.27
143 0.32
144 0.32
145 0.34
146 0.39
147 0.41
148 0.46
149 0.5
150 0.45
151 0.4
152 0.36
153 0.33
154 0.25
155 0.22
156 0.16
157 0.11
158 0.09
159 0.1
160 0.1
161 0.09
162 0.11
163 0.08
164 0.09
165 0.1
166 0.12
167 0.11
168 0.11
169 0.17
170 0.16
171 0.2
172 0.21
173 0.19
174 0.18
175 0.19
176 0.19
177 0.13
178 0.11
179 0.08
180 0.07
181 0.11
182 0.11
183 0.11
184 0.11
185 0.1
186 0.13
187 0.14
188 0.13
189 0.1
190 0.1
191 0.09
192 0.08
193 0.08
194 0.05
195 0.04
196 0.03
197 0.03
198 0.03
199 0.03
200 0.03
201 0.03
202 0.03
203 0.03
204 0.04
205 0.04
206 0.05
207 0.06
208 0.07
209 0.08
210 0.07
211 0.07
212 0.09
213 0.11
214 0.12
215 0.1
216 0.09
217 0.1
218 0.1
219 0.1
220 0.09
221 0.07
222 0.07
223 0.07
224 0.07
225 0.06
226 0.06
227 0.06
228 0.06
229 0.04
230 0.04
231 0.04
232 0.04
233 0.04
234 0.04
235 0.04
236 0.04
237 0.04
238 0.04
239 0.04
240 0.04
241 0.04
242 0.04
243 0.04
244 0.04
245 0.04
246 0.04
247 0.05
248 0.05
249 0.06
250 0.06
251 0.06
252 0.06
253 0.06
254 0.07
255 0.06
256 0.08
257 0.09
258 0.14
259 0.14
260 0.17
261 0.17
262 0.19
263 0.22
264 0.21
265 0.2
266 0.17
267 0.17
268 0.14
269 0.14
270 0.16
271 0.12
272 0.12
273 0.12
274 0.1
275 0.09
276 0.09
277 0.08
278 0.06
279 0.07
280 0.07
281 0.07
282 0.07
283 0.08
284 0.11
285 0.12
286 0.1
287 0.11
288 0.11
289 0.12
290 0.12
291 0.12
292 0.09
293 0.09
294 0.09
295 0.08
296 0.09
297 0.1
298 0.1
299 0.12
300 0.13
301 0.14
302 0.14
303 0.22
304 0.28
305 0.34
306 0.43
307 0.45
308 0.49
309 0.53
310 0.53
311 0.46
312 0.45
313 0.41
314 0.31
315 0.27
316 0.22
317 0.17
318 0.16
319 0.16
320 0.1
321 0.06
322 0.06
323 0.07
324 0.07
325 0.06
326 0.06
327 0.06
328 0.07
329 0.08
330 0.09
331 0.1
332 0.16
333 0.2
334 0.21
335 0.28
336 0.29
337 0.3
338 0.32
339 0.35
340 0.33
341 0.35
342 0.43
343 0.36
344 0.38
345 0.37
346 0.37
347 0.32
348 0.29
349 0.29
350 0.2
351 0.22
352 0.19
353 0.18
354 0.15
355 0.14
356 0.14
357 0.07
358 0.06
359 0.04
360 0.03
361 0.02
362 0.03
363 0.02
364 0.03
365 0.06
366 0.06
367 0.06
368 0.07
369 0.07
370 0.08
371 0.09
372 0.12
373 0.1
374 0.12
375 0.13
376 0.14
377 0.16
378 0.15
379 0.16
380 0.14
381 0.13
382 0.12
383 0.14
384 0.13
385 0.12
386 0.13
387 0.17
388 0.22
389 0.28
390 0.31
391 0.32
392 0.39
393 0.4
394 0.43
395 0.38
396 0.36
397 0.34
398 0.36
399 0.4
400 0.42
401 0.45
402 0.43
403 0.48
404 0.47
405 0.46
406 0.46
407 0.45
408 0.39
409 0.44
410 0.43
411 0.4
412 0.41
413 0.41
414 0.38
415 0.33
416 0.33
417 0.25
418 0.27
419 0.27
420 0.24
421 0.21
422 0.18
423 0.21
424 0.2
425 0.21
426 0.18
427 0.17
428 0.18
429 0.18
430 0.17
431 0.14
432 0.12
433 0.16
434 0.16
435 0.16
436 0.17
437 0.17
438 0.2
439 0.27
440 0.31
441 0.32
442 0.34
443 0.38
444 0.45
445 0.55
446 0.62
447 0.64
448 0.68
449 0.64
450 0.67
451 0.67
452 0.64
453 0.64
454 0.62
455 0.6
456 0.6
457 0.63
458 0.57
459 0.53
460 0.52
461 0.47
462 0.43
463 0.39
464 0.37
465 0.4
466 0.43
467 0.42
468 0.38
469 0.34
470 0.32
471 0.32
472 0.28
473 0.23
474 0.19
475 0.2
476 0.2
477 0.19
478 0.19