Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5E3WZ93

Protein Details
Accession A0A5E3WZ93    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
68-92VPHEPPVKSRRRRPRSGRVMRHVLRBasic
NLS Segment(s)
PositionSequence
74-88VKSRRRRPRSGRVMR
Subcellular Location(s) mito 26
Family & Domain DBs
Amino Acid Sequences MRMRRIQATWRVLLGIWAPKRWEYSITALQQYTTTPKPPPNPWVNKGTSTPTEAWKVAVSPSTMHSGVPHEPPVKSRRRRPRSGRVMRHVLRARAEAASALAAFFGTLERSPAVRVRASAHLARAYGGTVDDAPVEDAPDAVAPTPGPTGWA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.29
3 0.25
4 0.25
5 0.27
6 0.28
7 0.31
8 0.31
9 0.3
10 0.25
11 0.3
12 0.35
13 0.36
14 0.38
15 0.35
16 0.33
17 0.31
18 0.29
19 0.27
20 0.22
21 0.21
22 0.21
23 0.27
24 0.33
25 0.37
26 0.45
27 0.49
28 0.55
29 0.56
30 0.6
31 0.57
32 0.54
33 0.52
34 0.48
35 0.39
36 0.35
37 0.33
38 0.28
39 0.29
40 0.25
41 0.24
42 0.19
43 0.18
44 0.15
45 0.15
46 0.12
47 0.1
48 0.11
49 0.14
50 0.14
51 0.13
52 0.13
53 0.14
54 0.16
55 0.16
56 0.18
57 0.16
58 0.17
59 0.2
60 0.26
61 0.33
62 0.38
63 0.46
64 0.54
65 0.61
66 0.7
67 0.76
68 0.8
69 0.82
70 0.86
71 0.85
72 0.81
73 0.83
74 0.74
75 0.75
76 0.68
77 0.59
78 0.5
79 0.43
80 0.37
81 0.27
82 0.25
83 0.16
84 0.12
85 0.1
86 0.08
87 0.06
88 0.05
89 0.04
90 0.04
91 0.04
92 0.04
93 0.04
94 0.04
95 0.06
96 0.07
97 0.07
98 0.09
99 0.13
100 0.15
101 0.15
102 0.17
103 0.19
104 0.24
105 0.28
106 0.28
107 0.28
108 0.27
109 0.26
110 0.26
111 0.22
112 0.17
113 0.14
114 0.12
115 0.1
116 0.08
117 0.08
118 0.08
119 0.08
120 0.09
121 0.09
122 0.09
123 0.08
124 0.08
125 0.08
126 0.08
127 0.08
128 0.07
129 0.08
130 0.07
131 0.09
132 0.1