Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5E3WKT8

Protein Details
Accession A0A5E3WKT8    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
10-37TSSSGGKSAKKKKWSKGKVKDKAQHAVTHydrophilic
NLS Segment(s)
PositionSequence
14-31GGKSAKKKKWSKGKVKDK
Subcellular Location(s) nucl 13, mito 10, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKAKAAAPTSSSGGKSAKKKKWSKGKVKDKAQHAVTPDKALFDRIVKEVPTFRFISQSILIERLRVNGSLARIAIRHLEKEGSIKRIVHHHGQLIYTRASATE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.3
3 0.38
4 0.45
5 0.51
6 0.58
7 0.66
8 0.73
9 0.8
10 0.84
11 0.86
12 0.87
13 0.9
14 0.89
15 0.91
16 0.89
17 0.84
18 0.81
19 0.73
20 0.65
21 0.57
22 0.54
23 0.44
24 0.4
25 0.34
26 0.27
27 0.24
28 0.22
29 0.2
30 0.14
31 0.15
32 0.13
33 0.15
34 0.13
35 0.14
36 0.17
37 0.17
38 0.19
39 0.18
40 0.17
41 0.19
42 0.18
43 0.21
44 0.18
45 0.18
46 0.15
47 0.18
48 0.17
49 0.16
50 0.16
51 0.15
52 0.14
53 0.13
54 0.13
55 0.12
56 0.14
57 0.14
58 0.14
59 0.13
60 0.12
61 0.12
62 0.17
63 0.17
64 0.17
65 0.16
66 0.17
67 0.17
68 0.25
69 0.28
70 0.27
71 0.28
72 0.28
73 0.29
74 0.36
75 0.4
76 0.4
77 0.4
78 0.41
79 0.4
80 0.41
81 0.42
82 0.38
83 0.34
84 0.27